ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

Rab11A-controlled assembly of the inner membrane complex is required for completion of apicomplexan cytokinesis.

Agop-Nersesian, C., Naissant, B., Ben Rached, F., Rauch, M., Kretzschmar, A., Thiberge, S., Menard, R., Ferguson, D. J., Meissner, M., Langsley, G. (2009 Jan, PLoS Pathog)

The final step during cell division is the separation of daughter cells, a process that requires the coordinated delivery and assembly of new membrane to the cleavage furrow. While most eukaryotic cells replicate by binary fission, replication of apicomplexan parasites involves the assembly of daughters (merozoites/tachyzoites) within the mother cell, using the so-called Inner Membrane Complex (IMC) as a scaffold. After de novo synthesis of the IMC and biogenesis or segregation of new organelles, daughters bud out of the mother cell to invade new host cells. Here, we demonstrate that the final step in parasite cell division involves delivery of new plasma membrane to the daughter cells, in a process requiring functional Rab11A. Importantly, Rab11A can be found in association with Myosin-Tail-Interacting-Protein (MTIP), also known as Myosin Light Chain 1 (MLC1), a member of a 4-protein motor complex called the glideosome that is known to be crucial for parasite invasion of host cells. Ablation of Rab11A function results in daughter parasites having an incompletely formed IMC that leads to a block at a late stage of cell division. A similar defect is observed upon inducible expression of a myosin A tail-only mutant. We propose a model where Rab11A-mediated vesicular traffic driven by an MTIP-Myosin motor is necessary for IMC maturation and to deliver new plasma membrane to daughter cells in order to complete cell division.

PubMed: 19165333, full text

Localisation information

PFI1475w (MSP1, MSP-1, msp1 unprocessed, msp1, Msp-1 19, MSP1 19) merozoite surface protein 1

Experimental localisation: merozoite surface during merozoite, parasite plasma membrane during trophozoite, not apical during merozoite
  • Species: Plasmodium falciparum
  • Quote inferring localisation: "In merozoites as expected MSP1 decorates the surface [27,[28, whereas Rab11A now appears to lie just under the plasma membrane with an apical concentration typical of rhoptries."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: merozoite surface during merozoite, plasma membrane during trophozoite, not apical during merozoite

PF13_0119 (Rab11A, Rab11) Rab GTPase 11a

Experimental localisation: rhoptry during late schizont, parasite plasma membrane during trophozoite, parasite plasma membrane during schizont, under parasite plasma membrane during merozoite
  • Species: Plasmodium falciparum
  • Quote inferring localisation: "Figure 1. PfRab11A has a dynamic localisation. (AC) Throughout the erythrocytic stage of parasite development the localisation of PfRab11A changes. (A) Rhoptry localisation was confirmed in mature schizonts by immuno-staining infected blood smears with anti-PfRab11A and co-localisation (enlargement shown boxed in merge) demonstrated with anti-PfRhopH2 (rhoptry specific marker) antibodies. The bright-field image shows a mature schizont with the nuclei stained with Dapi. (B) PfRab11A co-localises partially with PfMSP1 (plasma membrane specific marker) in trophozoites (i, ii) and schizonts (iii). The merged images show co-localisation of the two proteins, giving single dots. In merozoites (iv), the localisation of PfMSP1 and PfRab11A is now distinct with PfRab11A having an apical localisation slightly under the plasma membrane decorated by PfMSP1. (C) The first two panels show the bright-field (phase) and Dapi, respectively. The last panel in all images shows an overlay. In young (i) and segmented (ii) schizonts, PfRab11A partially co-localises with PfGAP45 (Glidosome Associated Protein 45 used as an Inner Membrane Complex specific marker). "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during mature schizont, PM during troph and schizont, under PM during merozoite

PFI1445w (RhopH2) high molecular weight rhoptry protein 2

Experimental localisation: rhoptry during late schizont
  • Species: Plasmodium falciparum
  • Quote inferring localisation: "(A) Rhoptry localisation was confirmed in mature schizonts by immuno-staining infected blood smears with anti-PfRab11A and co-localisation (enlargement shown boxed in merge) demonstrated with anti-PfRhopH2 (rhoptry specific marker) antibodies."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during mature schizont

PFI1475w (MSP1, MSP-1, msp1 unprocessed, msp1, Msp-1 19, MSP1 19) merozoite surface protein 1

Experimental localisation: parasite plasma membrane during trophozoite, parasite plasma membrane during schizont, not under parasite plasma membrane during trophozoite, not under parasite plasma membrane during schizont
  • Species: Plasmodium falciparum
  • Quote inferring localisation: "PfRab11A co-localises partially with PfMSP1 (plasma membrane specific marker) in trophozoites (i, ii) and schizonts (iii)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PM and not under PM during troph and schizont

PFL1090w (GAP45) glideosome-associated protein 45

Experimental localisation: vesicle during early schizont, vesicle during late schizont, inner membrane complex during merozoite
  • Species: Plasmodium falciparum
  • Quote inferring localisation: "We also compared the sub-cellular localisation of Rab11A and the Glidosome Associated Protein 45 (GAP45) and observed double-positive vesicles (boxed area) consistent with the notion that their association is dynamic and that GAP45 might be delivered to the IMC via Rab11A-mediated pathway (Figure 1C). Once merozoites are formed, Rab11A is localised at the rhoptries and GAP45 at the IMC just under the plasma membrane (Figure 1A, Biv, and Cii)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: vesicles during young schizont and segmented schizont, IMC during merozoite

PBANKA_141890 (RAB11A) Rab GTPase 11a

Experimental localisation: cytoplasm during trophozoite, cytoplasm during gametocyte, apical during schizont
  • Species: Plasmodium berghei
  • Quote inferring localisation: "(B) PbRab11A localisation in trophozoites (T) and gametocytes (G) appears cytoplasmic, whereas in schizonts (lower panel) it appears more vesicular rhoptry-like."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: NK65
  • Gene model mapping comments: orthomcl from PF13_0119
  • Localisation record: cytoplasm during troph and gametocyte, apical during schizont

TGME49_089680 (Rab11, Rab11A) Ras family domain-containing protein

Experimental localisation: vesicle during intracellular tachyzoite, rhoptry during intracellular tachyzoite
  • Species: Toxoplasma gondii
  • Quote inferring localisation: "In absence of the inducer Shld-1 ddFKBP-mCherry tagged wild type Rab11A is rapidly degraded and only a weak background fluorescence can be detected that co-localises with the rhoptry protein 5 (Figure 4A), confirming the established rhoptry location of Rab11A within Toxoplasma [21]. Overexpression (+Shld-1) of Rab11Awt results in partial accumulation in an endosome-associated compartment as indicated by partial co-localisation with proM2AP [39]."
  • Microscopy type: Light
  • Microscopy method: mCherry tag
  • Strain: RH HXGPRT
  • Gene model mapping comments: Blast from SNMLSRFTRDEFNLESKSTIGVEFATKSVYLDEGKVIKAQIWDTAGQE from supplementary file 2 of 18468471
  • Localisation record: vesicles and rhoptry during intracellular tachyzoite

TGME49_014940 (M2AP, proTgM2AP) MIC2-associated protein M2AP

Experimental localisation: vesicle during intracellular tachyzoite
  • Species: Toxoplasma gondii
  • Quote inferring localisation: ""
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH HXGPRT
  • Gene model mapping comments: inferred from another publication
  • Localisation record: vesicles during intracellular tachyzoite

TGME49_108080 (ROP5) Rhoptry kinase family protein ROP5 (incomplete catalytic triad)

Experimental localisation: rhoptry during intracellular tachyzoite
  • Species: Toxoplasma gondii
  • Quote inferring localisation: "In the absence of Shld-1, weak background fluorescence can be detected that co-localises with the rhoptry marker Rop5"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH HXGPRT
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during intracellular tachyzoite