ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

Light microscopy using an antibody to protein or part thereof

Babesia equi

  • AB043618 (EMA-1) gi|8096552|dbj|AB043618.1| Babesia equi EMA-1 gene for merozoite antigen 1, complete cds (polyclonal antibody directly to protein)
  • AB013725 (EMA-2) gi|3142236|dbj|AB013725.1| Babesia equi gene for merozoite antigen 2, complete cds (polyclonal antibody directly to protein)

Plasmodium vivax

  • PVX_085930 (RAP1) rhoptry-associated protein 1, putative (polyclonal antibody)
  • PVX_000995 (Pv41) transmission-blocking target antigen Pfs230, putative (polyclonal antibody to whole protein)
  • PVX_111175 (Pvs25, Pvs28) ookinete surface protein Pvs25 (polyclonal antibody)
  • PVX_095475 (CTRP) CTRP adhesive protein (invasive stage), putative (antibody to orthologue)
  • PVX_003775 (MSP4) merozoite surface protein 4, putative (polyclonal antibody)
  • PVX_003770 (MSP5) merozoite surface protein 5 (polyclonal antibody)
  • PVX_110810 (DBP) Duffy receptor precursor (monoclonal antibody (mAb1C10))
  • PVX_090265 (TRAg) tryptophan-rich antigen (Pv-fam-a) (polyclonal antibody)
  • PVX_090935 (H2B) histone 2B (polyclonal antibody)
  • PVX_090075 (Pv34) hypothetical protein, conserved (polyclonal antibody to epitopes EVKAPKDDGGKEQDTLAGNK and VQNEIKNNEKLNKEKKSYDE)
  • PVX_118180 (LAP) leucine aminopeptidase, putative (polyclonal antibody to whole protein)
  • PVX_090930 (H4K5Ac) histone H4, putative (antibody to orthologue)
  • PVX_123575 (TRAMP) thrombospondin-related protein 3 precursor, putative (polyclonal antibody to epitopes AVGAGSQLGQAAQESDVNRK, NSQFTNEKVLEVYSSKEENV and DVKNPSEFEILSEPIKFSIS)
  • PVX_091405 (VX-4) vivapain-2 (polyclonal antibody)
  • PVX_117880 (RON2) hypothetical protein, conserved (polyclonal antibody)
  • PVX_092275 (AMA1) apical merozoite antigen 1 (polyclonal antibody)
  • No assigned gene identifier (RhopH3) (polyclonal antibody, antibody)
  • PVX_086930 (Clag7) cytoadherence linked asexual protein (CLAG), putative (polyclonal antibody to peptide)

Sarcocystis muris

  • AAA29805 (31-kDa) gi|160822|gb|AAA29805.1| 31-kDa major surface antigen [Sarcocystis muris] (monoclonal antibody)

Plasmodium chabaudi

Theileria lestoquardi

  • DQ004498 (clone-5) gi|63079800|gb|DQ004498.1| Theileria lestoquardi unknown protein long splice variant mRNA, complete cds, alternatively spliced (polyclonal antibody )

Eimeria maxima

Plasmodium gallinaceum

  • AB247370 (CTRP) gi|110681633|dbj|AB247370.1| Plasmodium gallinaceum pgctrp gene for circumsporozoite protein/thrombospondin-related anonymous protein-related protein, partial cds, strain:7A (antibody direct to protein, polyclonal antibody to homologue)
  • AF064079.1 (CHT1) gi|7530423|gb|AF064079.1| Plasmodium gallinaceum endochitinase precursor, mRNA, complete cds (antibody direct to protein, polyclonal antibody directly to protein)
  • No assigned gene identifier (WARP, CHT2) Nothing has been found (antibody direct to protein, monoclonal antibody, antibody)
  • PCAS_103520 (PM4) Nothing has been found (monoclonal antibody)

Plasmodium knowlesi

  • PKH_146970 (NBPXa) reticulocyte binding protein, putative (fragment) (polyclonal antibody directly to protein)
  • PKH_146980 (NBPXb) reticulocyte binding protein, putative (fragment) (polyclonal antibody directly to protein)
  • PKH_040760 (SPATR) SPATR protein, putative (polyclonal antibody directly to protein)
  • PKH_041300 (MSP-4, MSP4) merozoite surface protein, putative (polyclonal antibody directly to protein)
  • PKH_041310 (MSP-5, MSP5) merozoite surface protein 5 (polyclonal antibody directly to protein)

Theileria parva

  • TP01_0939 (-gp34) hypothetical protein (polyclonal antibody directly to protein)
  • TP04_0051 (PIM) polymorphic immunodominant molecule (monoclonal antibody)
  • TP03_0882 hypothetical protein (antibody to epitope)

Plasmodium falciparum

  • PFL1090w (GAP45) glideosome-associated protein 45 (polyclonal antibody directly against protein, GFP tag, polyclonal antibody directly to protein, antibody directly to protein, antibody)
  • PFI0880c (GAP50, SAP) glideosome-associated protein 50,secreted acid phosphatase (polyclonal antibody directly against protein, polyclonal antibody directly to protein, GFP tag after 99 amino acids, antibody, GFP tag)
  • PFL2225w (MTIP) myosin A tail domain interacting protein (antibody directly to protein, polyclonal antibody directly against protein, polyclonal antibody directly to protein, antibody)
  • PF13_0233 (MyoA, -myo1) myosin A (antibody, polyclonal antibody directly against protein, polyclonal antibody directly to protein)
  • PF10_0281 (MTRAP) merozoite TRAP-like protein (3' HA tag, 3' GFP tag, antibody, C terminal HA tag, polyclonal antibody directly to protein)
  • PF13_0201 (TRAP, SSP2) sporozoite surface protein 2 (polyclonal antibody directly to protein, Monoclonal antibody directly to protein)
  • PF10_0168-b (GRASP, GRASP1) golgi re-assembly stacking protein 1 (GFP tag, polyclonal antibody directly to protein, GFP tag, C terminal GFP tag, HA tag)
  • PF11_0461 (Rab6) Rab GTPase 6 (polyclonal antibody directly to protein, N terminal DsRed tag, antibody, N terminal GFP tag, antibody)
  • PFI0875w (grp, Hsp70-2, BiP) heat shock protein 70 (polyclonal antibody directly to protein, antibody)
  • PF13_0280 (ERD2) ER lumen protein retaining receptor (polyclonal antibody directly to protein, antibody)
  • PFD0810w (Sar1p, Sar1) small GTP-binding protein sar1 (N terminal GFP tag, C terminal GFP tag, antibody, polyclonal antibody directly to protein)
  • PFD0895c (Bet3p) Bet3 transport protein, putative (GFP, polyclonal antibody directly to protein)
  • MAL7P1.27 (CRT) chloroquine resistance transporter (polyclonal antibody directly to protein, FLAG tag, polyclonal antibody directly to protein, antibody, GFP tag)
  • PFB0640c (Sec31, Sec31p) sec31p (polyclonal antibody directly to protein)
  • PFB0340c (SERA5, SERP, p126, SERA, pl26) serine repeat antigen 5 (polyclonal antibody directly to protein, antibody)
  • PF14_0102 (RAP-1 p86, RAP-1 p82, RAP-1 p67, RAP1, RAP-1) rhoptry-associated protein 1 (Monoclonal antibody directly to protein, Monoclonal antibody 4E10 directly to protein, monoclonal antibody, polyclonal antibody directly to protein, GFP tag after 244 and 144 and 65 and 55 amino acids, antibody)
  • MAL13P1.231 (Sec61) Sec61 alpha subunit, PfSec61 (polyclonal antibody directly to protein)
  • PFE0065w (SBP1, SBP) skeleton-binding protein 1 (monoclonal antibody, polyclonal antibody directly to protein, antibody, Monoclonal antibody directly to protein)
  • MAL7P1.231 (HRPII, hrp2, pfhrp2, hrpII) histidine-rich protein II (GFP, polyclonal antibody directly to protein, myc tag, Monoclonal antibody directly to protein, antibody)
  • PF14_0076 (FAF-2, aspartic hemoglobinase I, PMI, PM1, Plasmepsin I, PM I) plasmepsin I (Monoclonal antibody directly to protein, antibody, monoclonal antibody)
  • PF14_0077 (PM II, PM2, PMII, Plasmepsin II) plasmepsin II (GFP, polyclonal antibody directly to protein, antibody)
  • PF14_0078 (HAP) plasmepsin III,histo-aspartic protease (Monoclonal antibody directly to protein, antibody)
  • PF14_0075 (PM IV, PM4) plasmepsin IV (polyclonal antibody directly to protein, antibody)
  • PF13_0133 (PM V, PM5, PMV) plasmepsin V (polyclonal antibody directly to protein, monoclonal antibody to residues 27-517, C terminal HA tag, antibody, YFP tag, GFP tag, antibody)
  • PF14_0281 (PM IX) plasmepsin IX (polyclonal antibody directly to protein)
  • PF08_0108 (PM X) plasmepsin X (polyclonal antibody directly to protein, GFP tag after 1kb)
  • MAL13P1.413 (MAHRP-1, MAHRP1, MAHRP) membrane associated histidine-rich protein (polyclonal antibody directly to protein, antibody, antbody)
  • PFA0110w (RESA) ring-infected erythrocyte surface antigen (antibody, monoclonal antibody, GFP tag after 117 amino acids, antibody directly to protein, antibody to C terminal)
  • PFI1735c (REX1) ring-exported protein 1 (GFP, polyclonal antibody directly to protein, antbody)
  • PFE0370c (SUB1) subtilisin-like protease 1 (antibody, antibody, HA tag)
  • PFL1960w (EMP1) erythrocyte membrane protein 1, PfEMP1 (polyclonal antibody directly to protein, antibody, YFP tag, GFP tag)
  • PFI1740c-a (REX2) ring-exported protein 2 (antibody, GFP tag)
  • PFI1755c (REX3, Rex3) ring-exported protein 3 (antibody, GFP, GFP tag)
  • PFD1120c (ETRAMP4, SEP4, Etramp 4, Etramp4) early transcribed membrane protein 4 (polyclonal antibody to myc tag and protein, polyclonal antibody directly to protein, myc tag, polyclonal antibody directly to protein, antibody)
  • PFB0120w (ETRAMP2, Etramp 2, Etramp2) early transcribed membrane protein 2 (polyclonal antibody directly to protein, myc tag, polyclonal antibody directly to protein, antibody)
  • PF10_0019 (ETRAMP10.1) early transcribed membrane protein 10.1 (polyclonal antibody directly to protein, myc tag, polyclonal antibody directly to protein)
  • PF10_0323 (ETRAMP10.2, J323) early transcribed membrane protein 10.2 (polyclonal antibody directly to protein)
  • PF14_0425 (aldolase, pfAldolase) fructose-bisphosphate aldolase (polyclonal antibody directly to protein, antibody, monoclonal antibody)
  • PF11_0224 (exp-1, EXP1, EXP-1) circumsporozoite-related antigen (polyclonal antibody directly to protein, Monoclonal antibody directly to protein, antibody, Monoclonal antibody to exp-1 and CSP, GFP tag)
  • PF11_0165 (Falcipain-2, FP2) cysteine proteinase falcipain 2a (GFP tag, polyclonal antibody directly to protein, polyclonal antibody directly to protein, GFP, antibody)
  • PFL1465c (HslV) heat shock protein hslv (polyclonal antibody directly to protein, C terminal EFYP tag, EYFP tag after 37 residues, antibody to GFP tag)
  • PFC0890w (Sec22) SNARE protein (GFP, GFP, antibody)
  • PFI1195c (TPK) thiamine pyrophosphokinase (polyclonal antibody directly to protein)
  • PF13_0322 (FLN) falcilysin (GFP tag, polyclonal antibody directly to protein)
  • PFB0385w (ACP) acyl carrier protein (polyclonal antibody directly to protein, GFP tag, antibody, DsRed tag, GFP tag after 40 amino acids, DsRed tag, antibody)
  • PF10_0153 (Cpn60, Hsp60, hsp60) heat shock protein 60 (polyclonal antibody directly to protein, GFP tag, DsRed tag, polyclonal antibody to homologue, antibody, Immunofluorescence data presented in Fig. 5 indicate that PfPPO colocalizes with PfHSP60, a mitochondrial marker, but not with PfPBGD, an apicoplast marker, establishing that PfPPO is a mitochondrial enzyme)
  • PFI1475w (MSP1, MSP-1, msp1 unprocessed, msp1, Msp-1 19, MSP1 19) merozoite surface protein 1 (polyclonal antibody directly to protein, antibody, monoclonal antibody, polyclonal antibody directly to protein, GFP tag, antibody directly to protein)
  • PF11_0344 (AMA-1, AMA1) apical membrane antigen 1 (polyclonal antibody directly to protein, Monoclonal antibody directly to protein, antibody, monoclonal antibody 28G2dc1 and 4G2dc1, Monoclonal antibody 4G2 directly to protein, monoclonal antibody, antibody directly to protein)
  • MAL7P1.176 (EBA-175, EBA175) erythrocyte binding antigen-175 (polyclonal antibody directly to protein, antibody, antibody directly to protein)
  • PFC0110w (CLAG 3.1, RhopH1 3.1, Clag3.1) cytoadherence linked asexual protein 3.2 (polyclonal antibody directly to protein, polyclonal antibody directly to protein epitope NQNENDTISQNVNQH, antibody)
  • PFC0525c (GSK-3) glycogen synthase kinase 3 (polyclonal antibody against homologue, monoclonal antibody to homologue)
  • PF11_0506 (Pf332) antigen 332, DBL-like protein (polyclonal antibody directly to protein, monoclonal antibody directly to protein, monoclonal antibody, antibody)
  • PF11_0301 (SPDS) spermidine synthase (polyclonal antibody directly to protein)
  • PF10_0121 (hypoxanthine phosphoribosyl transferase) hypoxanthine phosphoribosyltransferase (polyclonal antibody directly to protein)
  • PF13_0252 (NT1, ENT1) nucleoside transporter 1 (polyclonal antibody directly to protein, antibody)
  • PFB0210c (HT1) hexose transporter (polyclonal antibody directly to protein)
  • PF11_0396 (PP2C) protein phosphatase 2c (polyclonal antibody directly to protein)
  • PFD0310w (Pfs16) sexual stage-specific protein precursor (Monoclonal antibody directly to protein, polyclonal antibody directly to protein, antibody)
  • PFL0795c (mdv-1, peg3, mdv1, Mdv-1, Peg3) male development gene 1 (polyclonal antibody directly to protein, antibody)
  • PF11_0162 (Falcipain-3, FP3) cysteine proteinase falcipain 3 (polyclonal antibody directly to protein, GFP, antibody)
  • PFD0100c (surf4.1) surface-associated interspersed gene 4.1, (SURFIN4.1) (polyclonal antibody directly to protein)
  • PFD1160w (SURFIN4.2, Surf4.2) surface-associated interspersed gene 4.2, (SURFIN4.2) (polyclonal antibody directly to protein)
  • PFE0080c (RAP2) rhoptry-associated protein 2 (antibody, Monoclonal antibody directly to protein)
  • PF11_0168 (RON4, Pf225) rhoptry neck protein 4 (antibody, polyclonal antibody directly to protein, monoclonal antibody, Monoclonal antibody directly to protein, Monoclonal antibody, antibody directly to protein)
  • PF10_0306 (MORN1) MORN repeat protein, putative (polyclonal antibody against homologue)
  • PFL0480w (HMBS, PBGD) porphobilinogen deaminase (GFP tag, polyclonal antibody directly to protein, antibody, Immunofluorescence data presented in Fig. 5 indicate that PfPPO colocalizes with PfHSP60, a mitochondrial marker, but not with PfPBGD, an apicoplast marker, establishing that PfPPO is a mitochondrial enzyme)
  • PF14_0381 (PGBS, ALAD) delta-aminolevulinic acid dehydratase (GFP tag, polyclonal antibody directly to protein, polyclonal antibody against homologue)
  • PFL2210w (ALAS) delta-aminolevulinic acid synthetase (GFP tag, polyclonal antibody directly to protein, antibody)
  • PF10_0155 (enolase) enolase (polyclonal antibody directly against protein, polyclonal antibody directly to protein)
  • PFL1420w (MIF) macrophage migration inhibitory factor (polyclonal antibody directly to protein peptide NRSNNSALADQITKC)
  • PFI0450c (ARP) apoptosis-related protein, putative (polyclonal antibody directly to protein)
  • MAL8P1.17 (Pf52, PDI, DSI) protein disulfide isomerase (polyclonal antibody directly to protein, antibody)
  • MAL13P1.214 (pmt) phosphoethanolamine N-methyltransferase (GFP tag, polyclonal antibody directly to protein epitopes LDDGWSRKIKDSKRKMQR and SSGGLEATKKILSDIELN)
  • PFL0620c (Gatp) glycerol-3-phosphate acyltransferase (polyclonal antibody directly to protein)
  • PF14_0020 (CK) choline kinase (polyclonal antibody directly to protein, polyclonal antibody directly to whole protein)
  • PF14_0723 (CCp1) LCCL domain-containing protein (polyclonal antibody directly to protein, antibody)
  • PF14_0532 (CCp2) LCCL domain-containing protein (polyclonal antibody directly to protein)
  • PF14_0067 (CCp3) LCCL domain-containing protein (polyclonal antibody directly to protein, antibody)
  • PFI0185w (CCp4) LCCL domain-containing protein (polyclonal antibody directly to protein)
  • PFA0445w (CCp5) LCCL domain-containing protein (polyclonal antibody directly to protein)
  • PF14_0491 (FNPA) LCCL-like protein (polyclonal antibody directly to protein)
  • PF10_0303 (Pfs25, P25) 25 kDa ookinete surface antigen precursor (polyclonal antibody directly to protein, antibody, Monoclonal antibody directly to protein)
  • PFD0305c (Vacuolar ATP H+ Synthase subunit b) vacuolar ATP synthase subunit b (antibody, polyclonal antibody to homologue)
  • PF14_0053 (R2) ribonucleotide reductase small subunit (polyclonal antibody directly to protein)
  • PF10_0154 (R4) ribonucleotide reductase small subunit, putative (polyclonal antibody directly to protein)
  • PF13_0152 (Sir2) transcriptional regulatory protein sir2a (polyclonal antibody directly to protein peptides NSIWSKYDPRIYGTI and ANILKGSSEKNKKIM, antibody)
  • PF14_0068 (Nop1) fibrillarin, putative (polyclonal antibody directly to protein peptides GRGNKDRKSFKKDNK and GRGNKDRKSFKKDNK and DLTNMSKKRSNIVPI, antibody, antibody to homologue)
  • PF11_0061 (H4, h4k5ac, H4K5Ac, H4K8Ac, H4Ac4) histone H4 (polyclonal antibody to acetylated H4 homologue, antibody)
  • MAL13P1.326 (FC, HemH) ferrochelatase (polyclonal antibody directly to protein, epitope tag, antibody directly to protein)
  • PF11_0313 (P0) 60S ribosomal protein P0 (polyclonal antibody directly to protein)
  • PFB0405w (Pf230, Pfs230) 6-cysteine protein (Monoclonal antibody directly to protein, antibody)
  • PFI1730w (CLAG9) cytoadherence linked asexual protein 9 (polyclonal antibody directly to protein, Monoclonal antibody directly to protein, antibody)
  • PFI0265c (RhopH3, Rhop-3) high molecular weight rhoptry protein 3 (polyclonal antibody directly to protein, antibody, monoclonal antibody)
  • PFC0380w (YVH1) dual specificity phosphatase (polyclonal antibody directly to protein peptide SSIILSYVSKKNKKGIEYN)
  • PF10_0316 (PIG-A) N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein, putative (polyclonal antibody directly to protein peptide GKVKQENVKNILQTGH)
  • PFL0685w (PIG-O) phosphatidylinositol-glycan biosynthesis class O protein, putative (polyclonal antibody directly to protein peptide DKDKLKKNVNTLNEEN)
  • PF11_0427 (DPM1) dolichol phosphate mannose synthase (polyclonal antibody directly to protein peptide HPKYIYNFIKKQREKN)
  • MAL13P1.348 (GAA1) glycosylphosphatidylinositol anchor attachment 1 protein, putative (polyclonal antibody directly to protein peptide YNNTNRIGKKIIRSST)
  • MAL13P1.210 (PIG-B) dolichyl-phosphate-mannose-glygolipidalpha-mannosyltransferase, putative (polyclonal antibody directly to protein peptide NEDNIKRNEKDENNGN)
  • PF11_0098 (ERC, ERC1, Pfs40, Pf39) endoplasmic reticulum-resident calcium binding protein (polyclonal antibody directly to protein, antibody)
  • PFB0095c (EMP3) erythrocyte membrane protein 3 (polyclonal antibody directly to protein, antibody, C terminal GFP tag)
  • PFB0100c (KAHRP, HRP1) knob-associated histidine-rich protein (antibody, Monoclonal antibody directly to protein, GFP tag, GFP tag after 123 amino acids)
  • PFD1050w (alpha tubulin II, a-tubulin II) alpha tubulin 2 (polyclonal antibody against homologue, Monoclonal antibody directly to protein, antibody)
  • PFB0400w 6-cysteine protein (polyclonal antibody directly to protein)
  • PF11_0486 (MAEBL) merozoite adhesive erythrocytic binding protein (polyclonal antibody directly to protein)
  • MAL13P1.60 (EBA140, EBA-140, BAEBL) erythrocyte binding antigen-140 (polyclonal antibody directly to protein, antibody)
  • PFI1445w (RhopH2) high molecular weight rhoptry protein 2 (Monoclonal antibody directly to protein, polyclonal antibody directly to protein, Monoclonal antibody 4E10 directly to protein, polyclonal antibody directly to protein, monoclonal antibody, antibody)
  • PF07_0006 (STARP) sporozoite threonine and asparagine-rich protein (antibody)
  • PFF1105c (chorismate synthase, CS) chorismate synthase (polyclonal antibody directly to protein, antibody)
  • MAL13P1.185 (PK6) protein kinase 6 (polyclonal antibody directly to protein)
  • PFC1120c (Pf60) erythrocyte membrane protein 1, PfEMP1 (polyclonal antibody directly to protein)
  • PFA0410w (ARP) conserved Plasmodium protein, unknown function (polyclonal antibody directly to protein against epitopes 1493-2222 and 1493-1723)
  • PF14_0541 (VP1, V-type H(+)-translocating pyrophosphatase) V-type H( )-translocating pyrophosphatase, putative (GFP tag, polyclonal antibody against homologue)
  • PFE0545c (TCTP) translationally controlled tumor protein homolog, putative (antibody)
  • PF14_0761 (ACS1) acyl-CoA synthetase (polyclonal antibody directly to protein)
  • PF11_0381 (SUB2) subtilisin-like protease 2 (polyclonal antibody directly to protein)
  • PF11_0225 (GCN20) ABC transporter GCN20 (polyclonal antibody directly to protein)
  • PFB0310c (MSP-4, MSP4) merozoite surface protein 4 (polyclonal antibody directly to protein epitope 43-107, antibody)
  • PFF1370w (PK4) protein kinase PK4 (polyclonal antibody directly to protein epitope from nucleotides 868-1049 and 1034-1123)
  • PFE0040c (MESA, EMP2) mature parasite-infected erythrocyte surface antigen,erythrocyte membrane protein 2 (polyclonal antibody directly to protein, GFP tag after 87 amino acids, antibody)
  • PF10_0356 (LSA-1) liver stage antigen 1 (polyclonal antibody directly to protein)
  • PFA0125c (EBA-181, JSEBL, EBA181) erythrocyte binding antigen-181 (polyclonal antibody directly to protein, antibody)
  • PFD0295c (ASP) apical sushi protein (polyclonal antibody directly to protein, antibody)
  • PFL0870w (PTRAMP) thrombospondin-related apical membrane protein (polyclonal antibody directly to protein epitopes CFKGDLKESRP and EKELYENVAGRYMYD, polyclonal antibody directly to protein)
  • PFB0935w (CLAG2) cytoadherence linked asexual protein 2 (polyclonal antibody directly to protein)
  • MAL13P1.176 (RpfR2Ha, RBP-Hb, Rh2b, NBP2b) reticulocyte binding protein 2 homologue b (polyclonal antibody directly to protein, antibody)
  • PF13_0198 (RpfR2Hb, RBP-Ha, Rh2a, NBP2a) reticulocyte binding protein 2 homologue a (polyclonal antibody directly to protein, antibody)
  • PFD0240c ( 41, Pf41) 6-cysteine protein (polyclonal antibody directly to protein, GFP tag)
  • PFF0995c (MSP-10) merozoite surface protein 10 (polyclonal antibody directly to protein)
  • MAL7P1.208 (RAMA p60, RAMA) rhoptry-associated membrane antigen (antibody)
  • PFD0955w (Pf34, Pf-34) apical merozoite protein (polyclonal antibody directly to protein, antibody)
  • PF10_0345 (MSP3.1, MSP3) merozoite surface protein 3 (antibody, antibody directly to protein)
  • PFL1385c (ABRA, MSP9, MSP-9) merozoite surface protein 9 (antibody, antibody to epitopes NIISCNKNDKNQ and ANNSANNGKKNNAEE and YKAYVSYKKRKAQEK and LKNKIFPKKKEDNQAVDT and VPPTQSKKKNKNET and ENDVLNQETEEEMEK and TNDEEDTNDEEDTNDEED and KEEKEEKEEKEEKEKEKE)
  • PF13_0197 (p22, MSP7) merozoite surface protein 7 precursor (antibody)
  • PF10_0346 (MSP-6 36, MSP3.2, MSP6) merozoite surface protein 6 (antibody, antibody directly to protein)
  • PFB0345c (SERA4, SERA3) serine repeat antigen 4 (polyclonal antibody directly to protein, antibody)
  • PFD0110w (NBP-1, Rh1) normocyte binding protein 1,reticulocyte binding protein homologue 1 (antibody, polyclonal antibody directly to protein)
  • PFD1145c (Rh5, RH5) reticulocyte binding protein homologue 5 (C terminal HA tag, monoclonal antibody, antibody)
  • PFB0300c (MSP-2, Ag513) merozoite surface protein 2 (antibody)
  • PFB0305c-a (MSP-5) merozoite surface protein 5 (polyclonal antibody directly to protein)
  • PF10_0352 (H103, MSP3.6) merozoite surface protein (polyclonal antibody directly to protein, antibody directly to protein, C terminal GFP tag)
  • PF13_0348 (Rhop148) rhoptry protein (antibody)
  • PFE0120c (MSP-8) merozoite surface protein 8,ring-stage membrane protein 1 (antibody)
  • No assigned gene identifier (EBL-1) (antibody)
  • MAL7P1.119 (RALP1) rhoptry-associated leucine zipper-like protein 1 (GFP tag, C terminal Ty1 tag, antibody)
  • PFL0150w (Orc1, ORC1) origin recognition complex subunit 1 (antibody, polyclonal antibody directly to protein)
  • PFF0530w (Tk) transketolase (antibody)
  • PF11_0338 (AQP) aquaglyceroporin (antibody)
  • PFL1315w (K1, pfkch1) potassium channel protein (antibody)
  • PF14_0622 (K2) potassium channel protein (antibody)
  • PF14_0543 (SPP) signal peptide peptidase (antibody)
  • MAL13P1.167 (SP21) signal peptidase 21 kDa subunit (antibody directly to protein)
  • PFL2405c (g377) osmiophilic body protein (antibody)
  • PF10_0368 (DYN2) dynamin-like protein (antibody)
  • PF11_0465 (DYN1) dynamin-like protein (antibody)
  • PF13_0085 (UBC13) serine/threonine protein kinase (antibody)
  • PF14_0574 (FCP) conserved Plasmodium protein, unknown function (antibody, N terminal GFP tag)
  • PFI0580c (Falstatin) falstatin (antibody)
  • PF13_0248 (Pfs47) 6-cysteine protein (antibody)
  • PFL0145c (HMGB1) high mobility group protein (polyclonal antibody directly to protein)
  • MAL8P1.72 (HMGB2) high mobility group protein (polyclonal antibody directly to protein)
  • PFE1195w (Kb) karyopherin beta (antibody to homologue)
  • PF14_0748 (g14.748) Plasmodium exported protein (PHISTa), unknown function (antibody, polyclonal antibody directly to protein)
  • PFL0565w (j4) heat shock protein DNAJ homologue Pfj4 (antibody)
  • PF08_0054 (hsp, Hsp70-1) heat shock protein 70 (antibody)
  • PFI0930c (NAPS, NapS) nucleosome assembly protein (antibody, C terminal GFP tag, C terminal Cherry tag, GFP tag)
  • PFL0185c (NAPL) nucleosome assembly protein (antibody)
  • PFL2275c (FKBP35) FK506-binding protein (FKBP)-type peptidyl-propyl isomerase (antibody)
  • PF08_0129 (CnA) serine/threonine protein phosphatase, putative (antibody)
  • PF13_0080 (TERT) telomerase reverse transcriptase, putative (antibody)
  • PFA0590w (MRP, MRP1) ABC transporter, (CT family), putative (polyclonal antibody directly to protein epitopes CSNNNHLQNPDAFY and YASGIIKLYKEKNYV, polyclonal antibody directly to protein epitope CSNNNHLQNPDAFY and YASGIIKLYKEKNYV, polyclonal antibody directly to protein)
  • PF11_0174 (DPAP1) cathepsin C, homolog,dipeptidyl peptidase 1 (GFP, polyclonal antibody directly to protein against epitope TKKLDRKYLNNFDD )
  • PF14_0744 (g14.744) Plasmodium exported protein, unknown function (antibody, polyclonal antibody directly to protein)
  • PF14_0652 (D13) conserved Plasmodium protein, unknown function (Monoclonal antibody directly to protein)
  • PFL1620w (AARP1) asparagine and aspartate rich protein 1 (antibody)
  • PFE0690c (Rab1A) Rab GTPase 1a (antibody)
  • PF13_0119 (Rab11A, Rab11) Rab GTPase 11a (antibody, polyclonal antibody directly to protein)
  • PF11_0302 (PV-1) parasitophorous vacuolar protein 1 (polyclonal antibody directly to protein)
  • PF14_0678 (EXP2, EXP-2) exported protein 2 (Monoclonal antibody directly to protein, antibody directly to protein, antibody)
  • PFE0175c (MyoB) myosin B (antibody)
  • PFI0250c (Nup100) conserved Plasmodium membrane protein, unknown function (polyclonal antibody to epitope TSHDITDVQNSENKC, antibody)
  • PF13_0185 (CenP-A, H3 variant) histone H3 variant, putative (antibody)
  • PFF0865w (H3) histone H3 variant, putative (antibody)
  • PFF0510w (H3, h3k9m3, h3k9ac, H3K9Me1, H3K9me3, H3K9ac) histone H3 (antibody, antibody to homologue, antibody directly to protein)
  • PFL1435c (MyoD) myosin D (polyclonal antibody against residues 824-972)
  • PFE0285c (SUMO) small ubiquitin-related modifier, putative (polyclonal antibody against epitopes QGEHIQVKVRSPDGA and YDGDRIHGDNTPEQL, FLAG tag)
  • PF10_0395 (STEVOR) stevor (antibody)
  • PFL0040c (FIKK12) serine/threonine protein kinase, FIKK family (3' GFP tag after full length, antibody against epitope RFTKEKSDVRNSDEF)
  • PFD1165w (FIKK4.1) serine/threonine protein kinase, FIKK family (antibody against epitopes RRSQEVFKTEVKSKD and RHLKGNKRLRYYESY)
  • PFI0105c (FIKK9.3) serine/threonine protein kinase, FIKK family (antibody against epitopes CTNDYLKGTTTDSTKF and LNKVPTKNYSERSGR)
  • PFI0120c (FIKK9.6) serine/threonine protein kinase, FIKK family (antibody against epitopes NTYDEYESYKRIKK and NTYDEYESYKRIKK)
  • PFI0100c (FIKK9.2) serine/threonine protein kinase, FIKK family (antibody against epitope KNENYNESGGRNHEM)
  • PFC0160w (AnkDHHC) palmitoyl transferase (antibody)
  • PFD1150c (RH4) reticulocyte binding protein homologue 4 (3' GFP tag, antibody)
  • PFE0305w (TBP) transcription initiation factor TFiid, TATA-binding protein (antibody)
  • PFB0815w (CDPK1) calcium dependent protein kinase 1 (GFP tag after 48 amino acids, antibody)
  • PF14_0016 (SEP14) early transcribed membrane protein 14.1 (antibody)
  • PF11_0040 (SEP11.1) early transcribed membrane protein 11.2 (antibody)
  • PFL1885c (PK2) protein kinase 2 (antibody)
  • PFI1160w (LplA2) lipoate protein ligase a type 2 (GFP tag, antibody)
  • PF08_0066 (aLipDH) lipoamide dehydrogenase (GFP tag after first 134 amino acids, antibody)
  • PFL0590c (ATPase4) non-SERCA-type Ca2 -transporting P-ATPase (antibody)
  • PF14_0495 (RON2) rhoptry neck protein 2 (antibody)
  • PFI0230c (HU) bacterial histone-like protein (antibody)
  • PFE1510c (iTPT) triose phosphate transporter (C terminal HA tag, N terminal HA tag, YFP tag, antibody to epitope RNQPELFYDEQELKRINS)
  • PFE0410w (oTPT) triose phosphate transporter (antibody to epitope MKDNEKKNEYGTFPIS)
  • PF10_0363 (PyKII) pyruvate kinase 2, putative (antibody)
  • PFF0360w (UROD) uroporphyrinogen III decarboxylase (antibody)
  • PFB0480w (Stx1) syntaxin, Qa-SNARE family (polyclonal antibody directly to protein)
  • PFB0680w (RON6) rhoptry neck protein 6 (3' HA tag, antibody)
  • MAL13P1.310 (calpain) calpain (C terminal GFP, 2x flag tag, antibody to his tag, polyclonal antibody directly to protein)
  • PFF0895w (MDH) malate dehydrogenase (antibody)
  • MAL8P1.3 (25-IMP) Plasmodium exported protein (hyp9), unknown function (antibody)
  • PFL1005c (HP1, H1) heterochromatin protein 1 (antibody directly to protein, HA tag, Ty tag, GFP tag, Ty tag)
  • PF08_0012 (KMT1, SET3) SET domain protein, putative (C terminal HA tag, antibody directly to protein, antibody)
  • PF14_0706 conserved Plasmodium protein, unknown function (antibody directly to protein)
  • PF07_0072 (CDPK4) calcium dependent protein kinase 4 (antibody directly to protein)
  • PF14_0242 (PRMT1) arginine methyltransferase 1 (antibody directly to protein, GFP)
  • PFL2250c (PKB) RAC-beta serine/threonine protein kinase (polyclonal antibody directly to protein)
  • PF10_0348 (DBLMSP, MSP3.7, H103) duffy binding-like merozoite surface protein (N terminal GFP, C terminal GFP, polyclonal antibody directly to protein, antibody directly to protein, C terminal GFP tag)
  • PF10_0347 (MSP3.3, H101) merozoite surface protein (antibody directly to protein)
  • PF10_0350 (MSP3.4) probable protein, unknown function (antibody directly to protein)
  • PF10_0355 (MSP3.8) merozoite surface protein (antibody directly to protein)
  • PFB0570w (SPATR) secreted protein altered thrombospondin repeat protein (antibody directly to protein, C terminal GFP tag)
  • PFB0190c (Sel1) conserved Plasmodium protein, unknown function (polyclonal antibody directly against protein)
  • PF14_0462 (Sel2) ubiquitin-protein ligase, putative (polyclonal antibody directly against protein)
  • PF11_0220 (EK) protein kinase (polyclonal antibody directly against protein)
  • PF11_0139 (PRL, EP) protein tyrosine phosphatase (polyclonal antibody directly against protein)
  • PFE1545c (Formin1) formin 1, putative (antibody, Polyclonal antibody directly to protein)
  • PFL0925w (Formin2) formin 2, putative (antibody)
  • PF14_0344 (PTEX150) translocon component PTEX150 (polyclonal antibody directly to protein, HA tag, antibody)
  • PF11_0175 (HSP101, ClpB2) heat shock protein 101 (polyclonal antibody directly to protein, HA tag, HA tag)
  • PFB0106c Plasmodium exported protein, unknown function (polyclonal antibody directly to protein)
  • MAL7P1.172 Plasmodium exported protein (PHISTc), unknown function (polyclonal antibody directly to protein)
  • PF14_0758 Plasmodium exported protein (hyp17), unknown function (polyclonal antibody directly to protein)
  • PF11_0147 (map-2) mitogen-activated protein kinase 2 (polyclonal antibody directly to protein)
  • PF14_0517 (APP) aminopeptidase P (YFP tag, polyclonal antibody directly to protein)
  • PFI0550w (CRMP1) cysteine repeat modular protein 1 (polyclonal antibody directly to protein)
  • MAL7P1.92 (CRMP2) cysteine repeat modular protein 2 (polyclonal antibody directly to protein)
  • PF10_0271 (CEN3) centrin-3 (polyclonal antibody directly to protein)
  • PFC0140c (NSF) N-ethylmaleimide sensitive fusion protein, putative (polyclonal antibody directly to protein)
  • PF10_0023 (J23) Plasmodium exported protein (hyp16), unknown function (polyclonal antibody directly to protein)
  • PFE0060w (E60) parasite-infected erythrocyte surface protein (polyclonal antibody directly to protein)
  • PFA0680c (A680) Pfmc-2TM Maurer's cleft two transmembrane protein (polyclonal antibody directly to protein)
  • PF13_0328 (PCNA, PCNA1) proliferating cell nuclear antigen (polyclonal antibody directly to protein)
  • PFB0720c (ORC5) origin recognition complex subunit 5 (polyclonal antibody directly to protein)
  • PF13_0247 (s-48/45) 6-cysteine protein (Monoclonal antibody directly to protein)
  • PFE1150w (Pdh1, mdr1) multidrug resistance protein (polyclonal antibody directly to protein)
  • PFA0345w-b (CEN1) centrin-1 (polyclonal antibody directly to protein)
  • PFC0180c (ALV1) inner membrane complex protein 1a, putative (antibody)
  • PF14_0443 (CEN2) centrin-2 (polyclonal antibody directly to protein)
  • PF11_0066 (CEN4) centrin-4 (polyclonal antibody directly to protein)
  • PFI0180w (A-tubulin) alpha tubulin 1 (polyclonal antibody directly to protein, antibody)
  • PFL2510w (CHT1) chitinase (Monoclonal antibody directly to protein)
  • PFL1915w (GyrB) DNA gyrase subunit B (polyclonal antibody directly to protein)
  • PFL1120c (GyrA) DNA gyrase subunit A (polyclonal antibody directly to protein)
  • PFL1410c (MRP2) ABC transporter, (CT family) (polyclonal antibody directly to protein epitope LHYEGNLVDYIKKNNIVVKEDIVQTNKQCEKKSLTNEQVKSMLSLNEDWNYMHRVKKKSITQKETTKNYD and GST)
  • PF13_0218 (MDR5) ABC transporter (MDR family), putative (polyclonal antibody directly to protein epitope CQSTKYNSQCYQKNK)
  • PFE0420c (RCC1) guanidine nucleotide exchange factor (polyclonal antibody directly to protein)
  • PF11_0053 (SNF2L) chromatin remodeling protein (polyclonal antibody directly to protein)
  • PFD0255w (mag-1) ag-1 blood stage membrane protein homologue (polyclonal antibody to epitope, monoclonal antibody to epitope)
  • PFB0540w (H4K20me3) conserved Plasmodium protein, unknown function (C terminal GFP tag, antibody)
  • PFC0210c (CS) circumsporozoite (CS) protein (antibody, monoclonal antibody 3Sp2)
  • MAL7P1.91 (FEST) exported serine/threonine protein kinase (antibody)
  • PF11_0257 (EK) ethanolamine kinase, putative (polyclonal antibody directly to whole protein)
  • PF14_0368 (TPx-1) thioredoxin peroxidase 1 (polyclonal antibody directly to protein)
  • PF08_0131 (1-Cys-Prx) 1-cys peroxiredoxin (polyclonal antibody directly to protein)
  • PF14_0545 (Trx-1) thioredoxin, putative (polyclonal antibody directly to protein)
  • PFL0725w (pftrx-px2, TPx-2) thioredoxin peroxidase 2 (C terminal GFP tag, polyclonal antibody directly to protein)
  • PF14_0346 (PKG) cGMP-dependent protein kinase (Polyclonal antibody)
  • PFI1570c (DAP, M18AAP) M18 aspartyl aminopeptidase (YFP tag, polyclonal antibody directly to whole protein, GFP tag)
  • PFA0330w (AARP2) small ribosomal subunit assembling AARP2 protein (antibody )
  • PF11_0436 (CPO) coproporphyrinogen III oxidase (antibody to whole protein)
  • PFE0765w (PI3K) phosphatidylinositol 3-kinase (antibody directly to protein helival domain)
  • PF13_0229 (IRPa) aconitase (antibody directly to protein)
  • PF10_0164 (ETRAMP10.3) early transcribed membrane protein 10.3 (Polyclonal antibody against epitope KSWKNKNKSKDKVNDGSDSEELDSSKEDKDKDE)
  • PFC1050w (TSN, Tudor-SN) survival of motor neuron (SMN)-like protein (antibody, antibody to whole protein, antbody)
  • PFD0740w (crk-3) cdc2-related protein kinase 3 (antibody to H2N-CKNRRTLNEDMLSVVD-CONH2, antibody to H2N-PNERDIKTLRNLPCTN-CONH2, antibody to PNERDIKYLRNLPCWN)
  • MAL8P1.73 (RON5) rhoptry neck protein 5, putative (antibody)
  • PFA0670c (GEXP10) Plasmodium exported protein (hyp8), unknown function (antibody directly to protein)
  • PF14_0598 (pfGAPDH) glyceraldehyde-3-phosphate dehydrogenase (monoclonal antibody)
  • PF14_0097 (N-PfCDS) cytidine diphosphate-diacylglycerol synthase (antibody to GFP tag)
  • PF13_0338 (Pf92) cysteine-rich surface protein (GFP tag, antibody)
  • PF14_0201 (Pf113) surface protein, Pf113 (antibody)
  • PFD0462w (j1, DnaJA) heat shock protein 40 (antibody directly to protein)
  • PFC0310c (ClpP) ATP-dependent Clp protease proteolytic subunit (GFP tag after N terminal region, antibody directly to protein, antibody to GFP tag, HA tag)
  • PFD1105w (AARP) asparagine-rich protein (GFP tag, C terminal GFP tag, antibody)
  • PF10_0268 (MCP-1, nPrx) merozoite capping protein 1 (Monoclonal antibody, C terminal GFP tag, polyclonal antibody directly to protein)
  • PF13_0353 NADH-cytochrome b5 reductase, putative (antibody)
  • PFL1555w cytochrome b5, putative (antibody)
  • PFE0435c (SSB) single-strand binding protein, putative (polyclonal antibody to whole protein)
  • PF10_0275 (PPO) protoporphyrinogen oxidase (antibody to orthologue)
  • MAL13P1.56 (A-M1) M1-family alanyl aminopeptidase (YFP tag, antibody directly to protein)
  • PF13_0276 (MAHRP2) membrane-associated histidine rich protein 2, (MARHP2) (GFP tag, antibody)
  • MAL13P1.61 Plasmodium exported protein (hyp8), unknown function (antibody)
  • PFF0860c (H2A) histone H2A (antibody, antibody to Ty tag)
  • PFE0360c conserved Plasmodium protein, unknown function (GFP, antibody)
  • PFB0445c (U52) DEAD box helicase (antibody to whole protein)
  • PF08_0036 (Sec23) Pfsec23 (antibody)
  • PF08_0071 (SOD1) Fe-superoxide dismutase (antibody)
  • PFF1130c (SOD2) superoxide dismutase (GFP tag, Ty tag, antibody, GFP tag)
  • PF14_0177 (MCM2) minchromosome maintenance (MCM) complex subunit (antibody)
  • PF13_0291 (MCM6) minchromosome maintenance (MCM) complex subunit (antibody)
  • PFB0335c (SERP H, SERA6, SERP-H) serine repeat antigen 6 (antibody)
  • PFE0555w (SCD) stearoyl-CoA delta 9 desaturase, putative (antibody to GFP tag)
  • PFC0105w (SRPK1, CLK-4) serine/threonine protein kinase, putative (antibody to NVNKINCKVINKKNS)
  • PFE0160c (SR1) Ser/Arg-rich splicing factor, putative (antibody to whole protein)
  • PFC10_API0060 (ClpM) PFC10_API0060 (Polyclonal antibody to KNKNFLSKSDLKEIC)
  • PF10_0168-a (GRASP2) golgi re-assembly stacking protein 2 (GFP tag, antibody)
  • PFI0515w (Ykt6.1) SNARE protein, putative (Rabbit antibody to YLTKYKDPLN, N terminal GFP tag)
  • PF14_0534 (SHMTm) serine hydroxymethyltransferase, putative (polyclonal antibody to whole protein, GFP tag after N terminal region)
  • PFL1720w (SHMTc) serine hydroxymethyltransferase (polyclonal antibody to residues 369-438)
  • MAL13P1.279 (PK5, CDPK5) protein kinase 5 (polyclonal antibody directly to protein, antibody)
  • PFL2505c (RON3) conserved Plasmodium protein, unknown function (antibody to recombinant epitope)
  • PFC0635c (eIF4E) translation initiation factor 4E (antibody)
  • PF13_0095 (MCM4) minchromosome maintenance (MCM) complex subunit, putative (antibody)
  • PF14_0431 (CLK-1) protein serine/threonine kinase-1 (mouse antibody to epitope, myc tag)
  • PF14_0408 (SRPK2, CLK-2) serine/threonine protein kinase, putative (mouse antibody to epitope, myc tag)
  • MAL13P1.274 (PP5) serine/threonine protein phosphatase (polyclonal antibody to recombinantly expressed protein)
  • PFC0920w (H2A.Z) histone H2A variant, putative (antibody directly to protein)
  • PF10_0026 (PArt) tryptophan-rich antigen 3 (antibody)
  • PF14_0641 (Dxr) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (antibody to P. falciparum homologue)

Eimeria tenella

  • AJ586543 (SAG13) gi|37699787|emb|AJ586543.1| Eimeria tenella mRNA for surface antigen 13 (sag13 gene) (polyclonal antibody directly to protein)
  • AJ586535 (SAG4) gi|37699771|emb|AJ586535.1| Eimeria tenella mRNA for surface antigen 4 (sag4 gene) (polyclonal antibody directly to protein)
  • AJ306453 (MIC4) gi|187340650|emb|AJ306453.2| Eimeria tenella mRNA for microneme protein 4 (mic4 gene) (polyclonal antibody directly to protein)
  • EU093966 (MIC1) gi|156257451|gb|EU093966.1| Eimeria tenella microneme 1 precursor, mRNA, partial cds (monoclonal antibody)
  • AJ245536 (MIC5) gi|5708121|emb|AJ245536.1| Eimeria tenella mRNA for microneme protein 5 (mic-5 gene) (polyclonal antibody directly to protein)
  • AY512381 (MIC3) gi|40549146|gb|AY512381.1|AY512381S1 Eimeria tenella microneme protein MIC3 gene, partial cds (monoclonal antibody)
  • Z71755 (MIC2) gi|209414697|emb|Z71755.2| Eimeria tenella mRNA for acidic microneme protein precursor, clone Etmic-2 (polyclonal antibody directly to protein)
  • AY566297 (ENR) gi|50295339|gb|AY566297.1| Eimeria tenella enoyl-acyl carrier reductase (ENR) mRNA, complete cds (polyclonal antibody directly to protein, polyclonal antibody to synthetic peptide)
  • AJ586531 (SAG1) gi|38602660|emb|AJ586531.2| Eimeria tenella mRNA for surface antigen 1 (sag1 gene) (polyclonal antibody directly to protein, monoclonal antibody)
  • AJ586537 (SAG8) gi|37699775|emb|AJ586537.1| Eimeria tenella mRNA for surface antigen 8 (sag8 gene) (polyclonal antibody directly to protein)
  • AF042329 (Hsp90) gi|2792526|gb|AF042329.1| Eimeria tenella heat shock protein 90 (hsp90) mRNA, complete cds (polyclonal antibody directly to protein)
  • SNAP00000004971 (GAM56) Nothing has been found (monoclonal antibody, polyclonal antibody to homologue)
  • AF353515 (Enolase) gi|13774514|gb|AF353515.1| Eimeria tenella enolase mRNA, complete cds (polyclonal antibody directly to protein)
  • AF043910 (PYK) gi|2854032|gb|AF043910.1| Eimeria tenella pyruvate kinase (PYK) mRNA, complete cds (polyclonal antibody directly to protein)
  • No assigned gene identifier (MORN1) Nothing has been found (polyclonal antibody to homologue)
  • GQ463153 (GFAT) gi|258562383|gb|GQ463153.1| Eimeria tenella glucosamine: fructose-6-phosphate aminotransferase mRNA, partial cds (polyclonal antibody against epitope CNPDKPRGLAKTVTVS)

Toxoplasma gondii

  • TGME49_105160 (H2Ba) histone H2B, putative (polyclonal antibody directly to protein)
  • TGME49_088380 (Hsp90) heat shock protein 90 (antibody directly to protein, antibody)
  • TGME49_114250 (BRP1) hypothetical protein (antibody directly to protein)
  • TGME49_044030 (IMC3) hypothetical protein (YFP tag, monoclonal antibody directly to protein)
  • TGME49_063090 14-3-3 protein, putative (antibody directly to protein)
  • TGME49_018850 (S9, rps9) ribosomal protein S9, putative (GFP tag, antibody directly to protein, GFP tag, HA tag)
  • TGME49_064080 (ACP) acyl carrier protein (GFP tag, GFP tag, antibody directly to protein, YFP tag, polyclonal antibody directly to protein, antibody)
  • TGME49_047550 (Hsp60, HSP60) heat shock protein 60 (YFP tag, antibody to homologue, RFP tag, mRFP tag)
  • TGME49_032940 (Hsp20) small heat shock protein 20 (antibody directly to protein)
  • TGME49_086720 (Hsp28) heat shock protein 28 (antibody directly to protein)
  • TGME49_089600 (Hsp29) Hsp20/alpha crystallin domain-containing protein (antibody directly to protein)
  • TGME49_112600 (Hsp21) small heat shock protein 21 (antibody directly to protein)
  • TGME49_110440 (MORN1) phosphatidylinositol-4-phosphate 5-kinase, putative (antibody directly to protein, GFP tag, RFP tag, YFP tag, polyclonal antibody directly to protein, GFP tag, mCherry tag, GFP tag)
  • TGME49_066990 (BetaCOP) coatomer beta subunit, putative (antibody directly to protein)
  • TGME49_015780 (ROP2/3/4, ROP2, Tg3, Tg4, Tg34) Rhoptry kinase family protein ROP2A (incomplete catalytic triad) (antibody directly to protein, Monoclonal antibody directly to protein, antibody, polyclonal antibody directly to protein, monoclonal antibody)
  • TGME49_086450 (GRA5) dense granule protein 5 precursor (monoclonal antibody to protein, antibody directly to protein, HA tag, monoclonal antibody directly to protein, polyclonal antibody directly to protein)
  • TGME49_003310 (GRA7) dense granule protein 7 (antibody directly to protein, Monoclonal antibody directly to protein, polyclonal antibody directly to protein, antibody)
  • TGME49_075440 (GRA6) granule antigen protein GRA6 (antibody directly to protein, Monoclonal antibody directly to protein)
  • TGME49_070250 (GRA1) dense granule protein 1 / major antigenp24 (antibody directly to protein, Monoclonal antibody directly to protein, polyclonal antibody directly to protein)
  • TGME49_027620 (GRA2) 28 kDa antigen (antibody directly to protein, Monoclonal antibody directly to protein, polyclonal antibody directly to protein, antibody)
  • TGME49_110780 (GRA4) hypothetical protein (antibody directly to protein, BAP tag, antibody, polyclonal antibody directly to protein, Monoclonal antibody directly to protein, polyclonal antibody directly to protein)
  • TGME49_077240 (NTPase, NTP1) nucleoside-triphosphatase I (antibody directly to protein, polyclonal antibody directly to protein, monoclonal antibody, antibody)
  • TGME49_115490 (ROP10) hypothetical protein (antibody to fragment)
  • TGME49_119560 (MIC3, MIC 3) microneme protein MIC3 (antibody directly to protein, Monoclonal antibody directly to protein, polyclonal antibody directly to protein, YFP tag, GFP tag)
  • TGME49_054720 (GRA8) dense granule protein GRA8 (Monoclonal antibody directly to protein, polyclonal antibody directly to protein)
  • TGME49_032250 (Catalase) peroxisomal catalase (polyclonal antibody directly to protein, GFP, polyclonal antibody directly to protein)
  • TGME49_027280 (GRA3) dense granule protein 3 (antibody directly to protein, Monoclonal antibody directly to protein, polyclonal antibody directly to protein, antibody)
  • TGME49_051540 (GRA9) GRA9 protein, putative (antibody directly to protein)
  • TGME49_045490 (MIC8, MIC9) microneme protein 8 (polyclonal antibody directly to protein, Ty tag, mCherry tag)
  • TGME49_068900 (GRA10) dense granular protein GRA10 (Monoclonal antibody directly to protein)
  • TGME49_039740 (GRA14) hypothetical protein (antibody directly to protein, C terminal HA tag)
  • TGME49_029010 (RON4) hypothetical protein (Monoclonal antibody directly to protein, antibody directly to protein, polyclonal antibody directly to protein, antibody, antibody, HA tag)
  • TGME49_055260 (AMA1) apical membrane antigen 1, putative (Monoclonal antibody directly to protein, antibody, Monoclonal antibody directly to protein, polyclonal antibody directly to protein)
  • TGME49_091890 (MIC1, Mic 1) microneme protein MIC1 (Monoclonal antibody directly to protein)
  • TGME49_001780 (MIC2, MIC 2) microneme protein 2 (Monoclonal antibody directly to protein, myc tag, monoclonal antibody directly to protein, antibody)
  • TGME49_008030 (MIC4, MIC 4) microneme protein MIC4 (polyclonal antibody directly to protein, antibody, antibody directly to protein)
  • TGME49_077080 (MIC5) microneme TgMIC5 protein (YFP tag, antibody directly to protein, polyclonal antibody directly to protein)
  • TGME49_018520 (MIC6) microneme protein MIC6 (antibody directly to protein, polyclonal antibody directly to protein)
  • TGME49_061780 (MIC7) microneme protein 7 (Ty tag, polyclonal antibody directly to protein)
  • TGME49_033460 (SAG1, SRS29B, P30/SAG1, BSR4, P30) SRS29B (= SAG1, P30) (YFP tag, polyclonal antibody directly to protein, antibody, Monoclonal antibody directly to protein, cherry tag)
  • TGME49_050710 (MIC10) microneme protein 10 (polyclonal antibody directly to protein)
  • TGME49_014940 (M2AP, proTgM2AP) MIC2-associated protein M2AP (YFP tag, polyclonal antibody directly to protein, antibody)
  • TGME49_109590 (ROP1) rhoptry protein, putative (Monoclonal antibody directly to protein, antibody directly to protein, polyclonal antibody directly to protein, GFP tag, YFP tag)
  • TGME49_004530 (MIC11) microneme protein MIC11 (polyclonal antibody directly to protein)
  • TGME49_067680 (MIC12) microneme protein, putative (polyclonal antibody directly to protein)
  • TGME49_007130 (SAG2Y) SRS49A (= SAG2Y) (polyclonal antibody directly to protein)
  • TGME49_029630 (IF2K-A) protein kinase (incomplete catalytic triad) (antibody directly to protein)
  • TGME49_111510 (IF2K-B) PIK3R4 kinase-related protein (incomplete catalytic triad) (antibody directly to protein)
  • TGME49_095110 (ROP4) Rhoptry kinase family protein ROP4 / ROP7 (incomplete catalytic triad) ***WARNING: GENE MODEL INACCURATE *** (Monoclonal antibody directly to protein, GFP tag, antibody)
  • TGME49_015770 (ROP8) Rhoptry kinase family protein ROP8 (incomplete catalytic triad) (Monoclonal antibody to ROP2)
  • TGME49_006610 (PDH E2, PDHE2) biotin requiring domain-containing protein / 2-oxo acid dehydrogenases acyltransferase catalytic domain-containing protein (c terminal myc tag, polyclonal antibody directly to protein, Ty tag)
  • TGME49_061240 (H3) histone H3 (antibody to homologue, antibody, antibody to YFP tag)
  • TGME49_094270 (CARM1) arginine methyltransferase protein, putative (polyclonal antibody directly to protein)
  • TGME49_111430 (Fibrillarin) fibrillarin, putative (monoclonal antibody directly to homologue)
  • TGME49_036040 (Aldolase I, aldolase, aldolase-1) fructose-1,6-bisphosphate aldolase (c terminal myc tag, c terminal myc tag, antibody directly to protein, antibody directly to protein)
  • TGME49_031640 (IMC1, ALV1, IMC, NET1) membrane skeletal protein IMC1 (YFP tag, polyclonal antibody directly to protein, Monoclonal antibody directly to protein, polyclonal antibody to homologue, monoclonal antibody, CFP tag, antibody, Monoclonal antibody, YFP tag)
  • TGME49_072290 (PDH E1-beta, PDHE1b) pyruvate dehydrogenase E1 beta subunit, putative (c terminal myc tag, polyclonal antibody directly to protein, Ty tag)
  • No assigned gene identifier (PRX, PRX1, 49.m03355, OPN, Der1-2ER, Der1Ap, RNG1) (polyclonal antibody directly to protein, YFP tag, monoclonal antibody to homologue, 3xHA tag, YFP tag, mCherry tag)
  • TGME49_108080 (ROP5) Rhoptry kinase family protein ROP5 (incomplete catalytic triad) (polyclonal antibody directly to protein, antibody directly to protein)
  • TGME49_066130 (TPRX2, Prx2) glutathione/thioredoxin peroxidase, putative (polyclonal antibody directly to protein)
  • TGME49_057680 (MLC1) myosin light chain TgMLC1 (polyclonal antibody directly to protein, monospecific antibody directly to protein, YFP tag, Ty tag)
  • TGME49_023940 (GAP45) hypothetical protein (monospecific antibody directly to protein, antibody, antibody directly to protein)
  • TGME49_082050 (PP2Chn) hypothetical protein (antibody directly to protein)
  • TGME49_112270 (ROP13) hypothetical protein (polyclonal antibody directly to protein, antibody directly to protein)
  • TGME49_106060 (RON8) hypothetical protein (antibody directly to protein, antibody against His6 tagged protein, polyclonal antibody directly to protein, 3HA tag)
  • TGME49_089680 (Rab11, Rab11A) Ras family domain-containing protein (antibody directly to protein, mCherry tag)
  • TGME49_110010 (RON1) sushi domain-containing protein / SCR repeat-containing protein (antibody directly to protein)
  • TGME49_100100 (RON2) rhoptry neck protein 2 (antibody directly to protein, polyclonal antibody directly to protein)
  • TGME49_011290 (ROP15) hypothetical protein (antibody directly to protein)
  • TGME49_003990 (ROP12) hypothetical protein, conserved (antibody directly to protein)
  • TGME49_115220 (ROP14) rhoptry protein, putative (antibody directly to protein)
  • TGME49_023920 (RON3) hypothetical protein (antibody directly to protein)
  • TGME49_027810 (ROP11) Rhoptry kinase family protein ROP11 (incomplete catalytic triad) (antibody directly to protein)
  • TGME49_043730 (ROP9, p36) p36 protein (antibody directly to protein)
  • TGME49_062730 (ROP16) Rhoptry kinase family protein ROP16 (antibody directly to protein)
  • TGME49_067550 (LRR1) hypothetical protein, conserved (polyclonal antibody directly to protein, cMyc tag)
  • TGME49_110700 (PP1) serine/threonine protein phosphatase, putative (polyclonal antibody directly to protein, cMyc tag)
  • TGME49_112100 (A1, PMCA) Ca2+-ATPase (polyclonal antibody directly to protein)
  • TGME49_048670 (VP1, V-H+-PPase, VP-1) H+-translocating inorganic pyrophosphatase TVP, putative (YFP tag, polyclonal antibody to homologue, polyclonal antibody directly to protein, antibody)
  • TGME49_019280 (ALP1) actin, putative (antibody directly to protein, GFP tag, N terminal tandem GFP tag)
  • TGME49_009030 (ACT1) actin (polyclonal antibody directly to protein)
  • TGME49_059020 (BAG1) bradyzoite antigen, putative (Monoclonal antibody directly to protein, polyclonal antibody directly to protein, antibody)
  • TGME49_099070 (PK II, PyKII) pyruvate kinase, putative (c terminal myc tag, polyclonal antibody directly to protein)
  • TGME49_121570 (FABZ) (3R)-hydroxymyristoyl ACP dehydrase, putative (polyclonal antibody directly to protein)
  • TGME49_121530 (CPL) cathepsin L-like thiolproteinase, putative (YFP tag, antibody, polyclonal antibody directly to protein, monoclonal antibody against LARDEECRAQSCEKVV)
  • TGME49_060310 (ABC.B1, P-gp) ATP-binding cassette protein subfamily B member 1 (polyclonal antibody directly to protein, monoclonal antibody)
  • TGME49_111720 (BiP) heat shock protein 70, putative (polyclonal antibody directly to protein, GFP tag)
  • TGME49_085980 (glucosephosphate-mutase I, PRP1) phosphoglucomutase/parafusin related protein 1, putative (myc tag, polyclonal antibody directly to protein)
  • TGME49_111470 (RON5) hypothetical protein (antibody directly to protein, polyclonal antibody directly to protein)
  • TGME49_089770 (AP-1 u1 chain, ยต1) mu1 adaptin (Ty tag, polyclonal antibody directly to protein, HA tag)
  • TGME49_001840 (ASP1) eukaryotic aspartyl protease, putative (myc tag, Ty tag, polyclonal antibody directly to protein)
  • TGME49_076140 (ADP ribosylation factor 1, ARF1) ADP ribosylation factor 1 (C terminal HA tag, polyclonal antibody directly to protein)
  • TGME49_089620 (CPC1) cathepsin C (antibody directly to protein)
  • TGME49_076130 (CPC2) cathepsin C2 (TgCPC2) (antibody directly to protein)
  • TGME49_018840 (MSH-1) mismatch repair protein, putative (antibody directly to protein)
  • TGME49_006430 (Formin1, FRM1) formin homology 2 domain-containing protein (antibody)
  • TGME49_047230 (centrin) caltractin (centrin), putative (polyclonal antibody directly to protein, YFP tag, Monoclonal antibody directly to protein, GFP tag)
  • TGME49_052640 (PMA1) plasma-membrane H+-ATPase, putative (polyclonal antibody directly to protein epitope AVDQKNREVSRSSGK)
  • TGME49_034570 (HAD-2SCP-2) peroxisomal multifunctional enzyme type 2, putative (HA tag, polyclonal antibody directly to protein)
  • TGME49_039260 (H4, acetylated histone H4) histone H4, putative (antibody, polyclonal antibody to homologue)
  • TGME49_031850 (PP2C) serine-threonine phosophatase 2C (HA tag, polyclonal antibody directly to protein)
  • TGME49_073760 (HSP70) heat shock protein 70, putative (Monoclonal antibody directly to protein, antibody)
  • TGME49_049670 (tgcp1, toxopain-1, CP1, cathepsin B, CPB) cysteine proteinase, putative (YFP tag, monoclonal antibody)
  • TGME49_059200 (NHE1) Na+/H+ antiporter, putative (polyclonal antibody directly to protein)
  • TGME49_100200 (H2AZ) histone H2A (polyclonal antibody directly to protein)
  • TGME49_061580 (H2AX) histone H2A, putative (polyclonal antibody directly to protein)
  • TGME49_061250 (H2A1) histone H2A, putative (polyclonal antibody directly to protein)
  • TGME49_009910 (H2Bv1, h2b) histone H2B variant 1 (polyclonal antibody directly to protein, YFP tag, RFP tag, antibody)
  • TGME49_099060 (NHE2) sodium/hydrogen exchanger, putative (polyclonal antibody directly to protein)
  • TGME49_120110 (PCNA2) proliferating cell nuclear antigen, putative (polyclonal antibody directly to protein)
  • TGME49_068860 (ENO1) enolase 1 (c terminal myc tag, polyclonal antibody directly to protein)
  • TGME49_068850 (ENO2) enolase 2 (c terminal myc tag, polyclonal antibody directly to protein, antibody, polyclonal antibody)
  • TGME49_032350 (lactate dehydrogenase-1, LDH1) lactate dehydrogenase (C terminal myc tag, polyclonal antibody directly to protein)
  • TGME49_091040 (LDH2) lactate dehydrogenase (polyclonal antibody directly to protein)
  • TGME49_033480 (SRS2) SRS29C (= SRS2, P35) (polyclonal antibody directly to protein, MBP tag)
  • TGME49_007160 (SAG2C) SRS49D (= SAG2C) (polyclonal antibody directly to protein)
  • TGME49_070240 (MAG1, 65 kDa) cyst matrix protein (polyclonal antibody directly to protein)
  • TGME49_048830 (PI-PLC) phospholipase C delta 1 (polyclonal antibody directly to protein)
  • TGME49_068590 (ROM4) rhomboid-like protease 4 (HA tag, polyclonal antibody directly to protein, Ty tag, N-terminal myc tag)
  • TGME49_047540 (ABCG107) ABC transporter, putative (antibody)
  • TGME49_028170 (IMC2) serine/threonine protein phosphatase, putative (Monoclonal antibody directly to protein)
  • TGME49_033450 (SRS1) SRS29A (= SRS1) (antibody against amino acids 59-399)
  • TGME49_051930 (ENR) enoyl-acyl carrier reductase (polyclonal antibody directly to protein, Polyclonal antibody to whole protein)
  • TGME49_105860 (CDPKif3) CAM kinase, CDPK family TgCDPK1_2 (TGTPK4) (polyclonal antibody directly to protein)
  • TGME49_015070 (Fd) ferredoxin (antibody)
  • TGME49_014080 (Toxofilin) toxofilin (His6 tagged, C terminal HA tag, polyclonal antibody to whole protein, N terminal GFP tag)
  • TGME49_115560 (ABCG77) ABC transporter, putative (antibody)
  • TGME49_121640 (Cdc48Ap) cell division protein 48, putative (cmyc tag, antibody)
  • TGME49_007690 (PDCD5) double-stranded DNA-binding domain-containing protein (Polyclonal antibody to whole protein, Cterminal HA tag, HA tag after 106 amino acids, Polyclonal antibody to whole protein)
  • TGME49_111360 (PKG) AGC kinase TgPKG1 (antibody)
  • TGME49_090670 (LAP) cytosol aminopeptidase (Monoclonal antibody to HA tag, polyclonal antibody to whole protein)
  • TGME49_006580 (FRM2) hypothetical protein, conserved (antibody)
  • TGME49_093900 (SPATR) hypothetical protein (YFP tag, antibody)
  • TGME49_007080 (MYST-B) histone acetyltransferase (polyclonal antibody directly to protein)
  • TGME49_032660 (Hip) 58 kDa phosphoprotein, putative (antibody)
  • TGME49_121520 (-p23) P23 co-chaperone, putative (antibody)
  • TGME49_015450 (AQP1) aquaporin (antibody against LGYVGTHAYHNPVPLRFLNFRGL, C terminal myc tag)
  • TGME49_061980 (GRASP, GRASP55) gorasp2-prov protein (YFP tag, mRFP tag, mRFP tag, YFP tag, antibody, RFP tag)
  • TGME49_121620 (DrpB) dynamin-like protein, putative (GFP tag, antibody)
  • TGME49_067810 (Rab51, Rab5) Rab 5 (HA tag, antibody)
  • TGME49_090580 (ABCG89) ABC transporter, putative (antibody)
  • TGME49_089350 (ABCG84) white protein, putative (antibody)
  • TGME49_044270 (ABCG87) ABC transporter, putative (antibody to HA tag)
  • TGME49_088920 (ABCG96) ABC transporter, putative (antibody)
  • TGME49_089630 (MIC16) hypothetical protein (YFP tag, antibody to Ty tag)
  • TGME49_060820 (ISP1) hypothetical protein (antibody, monoclonal antibody, fixed light)
  • TGME49_004420 (OWP1) oocyst wall protein COWP, putative (antibody)
  • TGME49_009610 (OWP2) oocyst wall protein COWP, putative (antibody)
  • TGME49_068310 (OWP3) oocyst wall protein, putative (monoclonal antibody)
  • TGME49_003710 (AP2VIIa-4) hypothetical protein (antibody to YFP tag)
  • TGME49_040460 (AP2VI-1) malaria antigen, putative (antibody to YFP tag)
  • TGME49_109410 (AP2XI-1) hypothetical protein (antibody to YFP tag)
  • TGME49_051740 (AP2XII-9) hypothetical protein (antibody to YFP tag)
  • TGME49_080470 (AP2VIIa-1) hypothetical protein (antibody to YFP tag)
  • TGME49_016000 (IMC3) inner membrane complex protein IMC3 (antibody, YFP tag, antibody)
  • TGME49_024530 (IMC5) inner membrane complex associated protein 4 (antibody to N terminus)
  • TGME49_070380 (RPS13) 40S ribosomal protein S13, putative (antibody to rabbit homologue)
  • TGME49_006510 (TLN4) peptidase M16 domain containing protein (YFP tag, antibody)
  • TGME49_025410 (CenH3, CenpA) histone H3 variant, putative (antibody to YFP tag, HA tag)
  • TGME49_018260 (H3.3) histone H3.3 variant (antibody to YFP tag)
  • TGME49_016600 (APE) DNA-(apurinic or apyrimidinic site) lyase, putative (antibody directly to protein, FLAG tag)
  • TGME49_088680 (APN) endonuclease V, putative (antibody directly to protein, FLAG tag)
  • TGME49_007900 (ORF25.m01787) transcription factor IIIB subunit, putative (antibody, 3HA tag)
  • TGME49_047460 (pCNA, PCNA1) proliferating cell nuclear antigen 1 (YFP tag, GFP tag, antibody)
  • TGME49_021380 (NF5) hypothetical protein, conserved (antibody)
  • TGME49_018820 (NF6) hypothetical protein, conserved (antibody)
  • TGME49_048810 (NF7) hypothetical protein (antibody)
  • TGME49_105180 (NHE3) sodium/hydrogen exchanger, putative (antibody to residues 917-116, HA tag)
  • TGME49_014850 (Dxr) 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative (antibody to P. falciparum homologue)

Babesia divergens

  • EU219619 (Bd17, BDHSP20) gi|164710611|gb|EU219619.1| Babesia divergens HSP-20 (hsp-20) mRNA, complete cds (monoclonal antibody directly to protein)

Theileria annulata

  • TA14920 (HSP70, mthsp70) heat shock protein HSP70 homologue, putative (polylonal antibody)
  • TA20205 (SE) schizont protein e (polyclonal antibody directly to protein)
  • TA19865 (D) surface protein d precursor (polyclonal antibody directly to protein)
  • TA10630 (CKIIalpha) casein kinase II, alpha subunit, putative (polylonal antibody)
  • TA03135 (SuAT1) Tash(AT)-like protein, putative (polylonal antibody)
  • TA20085 (shAT1) Tashat1 protein (polyclonal antibody )
  • TA20095 (shAT2) Tashat2 protein (C-terminal GFP, polyclonal antibody )
  • TA20082 (shAT3) Tashat3 protein (polyclonal antibody )
  • TA06730 (CRK3) cdc2-like kinase (polyclonal antibody )
  • TA06510 (-gp34) hypothetical protein (polyclonal antibody directly to protein)
  • TA17315 (PIM) surface protein precursor (TaSP), putative (monoclonal antibody)

Plasmodium berghei

  • PBANKA_092670 (EXP-1, EXP1) circumsporozoite-related antigen (antibody directly to protein, chicken antibody, polyclonal antibody directly to protein, polyclonal antibody)
  • PBANKA_110220 (MSP8) merozoite surface protein 8 (antibody directly to protein, antibody)
  • PBANKA_091560 (AQP) aquaglyceroporin (Epitope-specific antibody)
  • PBANKA_145930 (Actin) actin, putative (IFA from monoclonal antibody, antibody)
  • PBANKA_135570 (MyoA) myosin A (IFA from antibodies, antibody)
  • PBANKA_145950 (MTIP) myosin A tail domain interacting protein MTIP, putative (antibody directly to protein, polyclonal antibody directly to protein)
  • PBANKA_110330 (MyoB) myosin pfm-b, putative (IFA from antibodies)
  • PBANKA_051500 (P25, P28, Pbs25) 25 kDa ookinete surface antigen precursor (antibody directly to protein, Monoclonal antibody directly to protein, Monoclonal antibody directly to homologue, polyclonal antibody directly to protein, monoclonal antibody, antibody, Monoclonal antibody)
  • PBANKA_052480 (SEP1, SEP3) early transcribed membrane protein (antibody directly to protein)
  • PBANKA_040260 (IMC1a) inner membrane complex protein 1a (polyclonal antibody directly to protein)
  • PBANKA_093350 (ROM1) rhomboid 1 (antibody directly to protein)
  • PBANKA_141030 (A-M1) M1-family aminopeptidase, putative (antibody to homologue)
  • PBANKA_070280 (PDI) protein disulfide isomerase (antibody to homologue)
  • PBANKA_041290 (CTRP) circumsporozoite- and TRAP-related protein (antibody, Monoclonal antibody directly to protein, polyclonal antibody directly to protein, monoclonal antibody)
  • PBANKA_103520 (SR, lap1, Lap1) LCCL domain-containing protein (antibody to epitope, polyclonal antibody, GFP tag, RFP tag)
  • PBANKA_081890 (Bip, BiP, grp) heat shock protein 70, putative (polyclonal antibody directly to protein, polyclonal antibody to homologue)
  • PBANKA_102460 (LISP1) liver specific protein 1 (antibody directly to protein)
  • PBANKA_051490 (Pbs21) 28 kDa ookinete surface protein (monoclonal antibody directly to protein, antibody)
  • PBANKA_100630 (SPECT2) perforin like protein 1 (polyclonal antibody directly to protein)
  • PBANKA_081990 (SET) nucleosome assembly protein (polyclonal antibody directly to protein, GFP tag)
  • PBANKA_041770 (Alpha tubulin) alpha tubulin 1 (monoclonal antibody to homologue)
  • PBANKA_090130 (MAEBL) merozoite adhesive erythrocytic binding protein (polyclonal antibody directly to protein)
  • PBANKA_134980 (TRAP) thrombospondin-related anonymous protein (polyclonal antibody directly to protein, Monoclonal antibody directly to protein, polyclonal antibody)
  • PBANKA_040320 (CS, CSP) circumsporozoite (CS) protein (Monoclonal antibody directly to protein, antibody, polyclonal antibody)
  • PBANKA_071190 (hsp70) heat shock protein, putative (polyclonal antibody to homologue, Monoclonal antibody directly to protein)
  • No assigned gene identifier (SPECT, SBP) (antibody directly to protein, polyclonal antibody to homologue)
  • PBANKA_143220 (mdv-1, MDV-1, PEG3) male development gene 1 (polyclonal antibody directly to protein, GFP tag)
  • PBANKA_122890 (WARP) von willebrand factor a-domain-related protein (polyclonal antibody directly to protein residues 285-303)
  • PBANKA_143360 (PTRAMP) thrombospondin-related apical membrane protein (polyclonal antibody to homologue)
  • PBANKA_030510 (SERA1) serine repeat antigen 1 (antibody, 3' mCherry tag, antibody to C terminus)
  • PBANKA_121810 (Cap380) oocyst capsule protein (polyclonal antibody, antibody)
  • PBANKA_030500 (SERA2) serine repeat antigen 2 (3' mCherry tag, antibody to middle of protein)
  • PBANKA_103780 (SOAP) secreted ookinete adhesive protein (antibody directly to protein)
  • PBANKA_081300 (ICP) inhibitor of cysteine proteases (polyclonal antibody to C terminal domain, polyclonal antibody)
  • PBANKA_020930 (Arp1) actin-related protein (antibody)
  • PBANKA_112690 (eIF2a, PK4) protein kinase, putative (antibody to homologue)
  • PBANKA_143920 (PABP) polyadenylate-binding protein, putative (antibody to homologue)

Babesia microti

Neospora caninum

  • NCLIV_043270 (MIC1) microneme protein MIC1, putative (polyclonal antibody directly to protein)
  • NCLIV_022970 (MIC2) microneme protein 2, putative (polyclonal antibody directly to protein, antibody)
  • No assigned gene identifier (MIC3, -P38, MIC4, -p43, BAG1, SAG1, p29, SRS2, p35) (monoclonal antibody directly to protein, polyclonal antibody directly to protein, polyclonal antibody to homologue, monoclonal antibody to homologue)
  • NCLIV_028680 (AMA1) apical membrane antigen 1, putative (polyclonal antibody directly to protein)
  • NCLIV_061830 (P0) 60S acidic ribosomal protein P0 (polyclonal antibody directly to protein)
  • NCLIV_058810 (SOD) superoxide dismutase (polyclonal antibody directly to protein)
  • NCLIV_011410 (PDI) protein disulfide isomerase (polyclonal antibody directly to protein)
  • NCLIV_028990 (56-kDa antigen) hypothetical protein (polyclonal antibody directly to protein)
  • NCLIV_056880 (PI-S) hypothetical protein, conserved (polyclonal antibody directly to protein)
  • NCLIV_036400 (GRA1) dense granule protein 1 / major antigenp24, putative (polylonal antibody)
  • NCLIV_045650 (GRA2) 28 kDa antigen, putative (polylonal antibody)
  • NCLIV_021640 (GRA7, NCDG1) dense granule protein 7, putative (polylonal antibody, polyclonal antibody to whole protein)
  • NCLIV_021050 (SUB1, p65) hypothetical protein (polyclonal antibody directly to protein)
  • NCLIV_070010 (RON4) hypothetical protein, conserved (antibody to homologue)
  • NCLIV_000610 (Profilin) profilin family protein, putative (polyclonal antibody directly to protein)
  • NCLIV_036410 (MAG1) cyst matrix protein, putative (antibody to whole protein)
  • NCLIV_033690 (MIC2-like1) hypothetical protein (antibody)
  • NCLIV_030050 (RON4) hypothetical protein, conserved (antibody to toxoplasma orthologue)
  • NCLIV_001970 (ROP2) hypothetical protein (antibody)
  • NCLIV_038110 (MIC17B) hypothetical protein (monoclonal antibody)

Babesia gibsoni

  • DQ386864 (RAP-1a) gi|88770793|gb|DQ386864.1| Babesia gibsoni rhoptry-associated protein mRNA, complete cds (polyclonal antibody directly to protein)
  • AB480715 (RAP-1b) gi|255708245|dbj|AB480715.1| Babesia gibsoni BgRAP-1b mRNA for rhoptry-associated protein-1b, complete cds (polyclonal antibody directly to protein)
  • AB480716 (RAP-1c) gi|255708247|dbj|AB480716.1| Babesia gibsoni BgRAP-1c mRNA for rhoptry-associated protein-1c, complete cds (polyclonal antibody directly to protein)
  • AB051834 (P50) gi|14646758|dbj|AB051834.1| Babesia gibsoni P50 mRNA, complete cds (polyclonal antibody directly to protein)
  • FJ608703 (P22) gi|223036619|gb|FJ608703.1| Babesia gibsoni isolate BgP22 merozoite 22-kDa protein mRNA, partial cds (polyclonal antibody directly to protein)
  • AB490782 (LAP) gi|253735627|dbj|AB490782.1| Babesia gibsoni BgLAP mRNA for leucine aminopeptidase, complete cds (polyclonal antibody directly to protein)
  • AB083515 (Hsp70) gi|23867855|dbj|AB083515.1| Babesia gibsoni hsp70 mRNA for heat shock protein 70, complete cds, strain: Korea4 (polyclonal antibody directly to protein)

Babesia bovis

  • BBOV_II002650 (TRAP) thrombospondin-related anonymous protein (polyclonal antibody directly to protein)
  • BBOV_IV011230 (AMA-1) apical membrane antigen 1 (polyclonal antibody directly to protein)
  • BBOV_II004970 (TPx-1) thioredoxin peroxidase-like protein (polyclonal antibody directly to protein)
  • BBOV_II000740 (SBP2, 225-kDa) Spherical Body Protein 2 (SBP2) (monoclonal antibody)
  • BBOV_I004210 (SBP3) spherical body protein 3 (monoclonal antibody)
  • BBOV_II002880 (Bb-1, SBP-1) 85 kDa protein (polyclonal antibody directly to protein, antibody)
  • BBOV_IV009860 (RAP-1) rhoptry-associated protein 1 (RAP-1) (monoclonal antibody directly to protein, monoclonal antibody, antibody, monoclonal antibody BABB75A4)
  • BBOV_I003020 (MSA-2c) merozoite surface antigen-2c (MSA-2c) (monoclonal antibody, antibody)
  • BBOV_I003060 (MSA-1) merozoite surface antigen-1 (MSA-1) (antibody)
  • BBOV_I003010 (MSA-2a1) merozoite surface antigen-2a1 (MSA-2a1) (antibody)
  • BBOV_I003000 (MSA-2a2) merozoite surface antigen-2a2 (MSA-2a2) (antibody)
  • BBOV_I002990 (MSA-2b) merozoite surface antigen-2b (MSA-2b) (antibody)
  • No assigned gene identifier (o-MIC1) (antibody to epitopes KEYIHEIKAATLNSLIRKNC and GCYRDDEVSYDI)
  • BBOV_II001180 (o-6cys-E) hypothetical protein (antibody to GPDTPHDKVLEAAQC, antibody to KSDGIANHRNDAG)
  • BBOV_IV007730 (bovipain-2) cysteine protease 2 (antibody)
  • BBOV_IV005390 (SBP-4) spherical body protein 4 SBP4 (antibody)
  • BBOV_IV010280 (RRA) RAP-1 related antigen (RRA) (polyclonal antibody to peptide fragment)

Plasmodium yoelii

  • PY00454 (PLP1) MAC/Perforin domain, putative (Polyclonal antibody to whole protein)
  • PY06203 (pypAg-1) blood-stage membrane protein Ag-1 (polyclonal antibody to whole protein)
  • PY03625 (pypAg-3) secreted blood-stage antigen pAg-3 (polyclonal antibody to whole protein)
  • PY06415 (pAg-2) merozoite surface protein precursor (polyclonal antibody to whole protein)
  • PY02159 (P140, RON4) Drosophila melanogaster CG15040 gene product (monoclonal antibody to whole protein, monoclonal antibody)
  • PY04858 (CTRP) ookinete protein-related (antibody to orthologue)
  • PY04499 (LISP1) hypothetical protein (antibody to native protein)
  • PY04421 (HEP17, exp-1) U43539 hepatocyte erythrocyte protein 17 kDa (monoclonal antibody, antibody)
  • PY00409 (MTIP) myosin A tail domain interacting protein MTIP (antibody to native protein)
  • PY01232 (MyoA) myosin A (antibody)
  • PY03052 (TRAP) sporozoite surface protein 2 precursor (monoclonal antibody to homologue, antibody)
  • PY06644 (enolase) enolase (polyclonal antibody directly to protein, polyclonal antibody directly to homologue)
  • PY05977 (MAEBL) erythrocyte binding protein (polyclonal antibody directly to homologue)
  • PY05748 (MSP-1, MSP1) merozoite surface protein 1 precursor (monoclonal antibody, antibody)
  • PY01581 (AMA1) apical membrane antigen-1 (monoclonal antibody to homologue, monoclonal antibody, polyclonal antibody)
  • PY07092 (TRSP) hypothetical protein (antibody)
  • PY03168 (CS, CSP, S2) circumsporozoite protein (antibody)
  • PY00204 (S3, UIS4) hypothetical protein (antibody)
  • PY03011 (S7) early transcribed membrane protein family (antibody)
  • PY00414 (2-Cys Prx) thioredoxin peroxidase 1 (polyclonal antibody directly to homologue)
  • PY04285 (1-Cys Prx) 1-cys peroxidoxin (polyclonal antibody directly to homologue)
  • PY00522 (Pys25) 28 kDa ookinete surface protein (monoclonal antibody, polyclonal antibody directly to homologue)
  • PY03846 (FabI) enoyl-acyl carrier reductase (antibody, myc tag)
  • No assigned gene identifier (H4K5Ac) (antibody to orthologue)
  • PY01365 (PY01365) rhoptry protein (monoclonal antibody)
  • PY04764 (EBL) duffy receptor, beta form precursor (Polyclonal antibody, polyclonal antibody)

Sarcocystis neurona

  • AF532594 (MIC10) gi|22347778|gb|AF532594.1| Sarcocystis neurona microneme antigen 10 (MIC10) mRNA, complete cds (polylonal antibody)
  • AY325815 (NTP1) gi|32816823|gb|AY325815.1| Sarcocystis neurona nucleoside triphosphate hydrolase (NTP) mRNA, complete cds (polyclonal antibody directly to protein)

Cryptosporidium parvum

  • cgd6_4840 (SUB1) serine protease, subtilase family, signal peptide (polyclonal antibody directly to protein)
  • cgd6_1080 (gp40/15, gp15, gp-15, GP15, GP40, gp40) conserved hypothetical protein (monoclonal antibody, polyclonal antibody directly to protein, antibody, polyclonal antibody)
  • cgd3_2180 (FAS1 Type I) type I fatty acid synthase (polyclonal antibody directly to protein)
  • cgd8_4740 (SFP-PPT, PPTase) phosphopantetheinyl transferase (polyclonal antibody directly to protein, polyclonal antibody)
  • cgd4_2900 (PKS1) polyketide synthase (polyclonal antibody to CKHENSIEFNDKDCMKRNLVC)
  • cgd6_4970 (n60, Cpn60, Hsp60) Hsp60; GroEL-like chaperone (ATpase), predicted mitochondrial (polyclonal antibody directly to protein, antibody to homologue, polyclonal antibody to homologue)
  • cgd1_3500 (TRAP-C1) thrombospondin related adhesive protein (polyclonal antibody directly to protein)
  • cgd6_780 (MIC1, TSP8) CpTSP8,predicted extracellular protein with 3 TSP1 repeats, an EGF domain and a C-terminal transmembrane domain. adjacent TSP domain containing gene. (polyclonal antibody directly to protein)
  • cgd6_5410 (CP2) signal peptide plus thr stretch, charged repeats, likely mucin (polyclonal antibody directly to protein, polyclonal antibody to whole protein)
  • cgd1_700 (ABC, ABC1) ATP-binding cassette protein (polyclonal antibody directly to protein)
  • cgd1_3530 (Gbp) Gbp1/Gbp2p-like, putative single stranded G-strand telomeric DNA-binding protein (monoclonal antibody)
  • cgd7_1730 (a135) CpCCp1/Cpa135 (monoclonal antibody directly to protein, monoclonal antibody SA35)
  • cgd2_70 (ABC2) ABC transporter, with 12 x transmembrane domains and 2x AAA domains (polyclonal antibody directly to protein)
  • cgd3_3440 (-mtHSP70) heat shock protein HSP70, mitochondrial (antibody to whole protein without mitochondrial presequence)
  • cgd6_2090 (COWP-190, COWP, COWP1) CpCOWP1, oocyst wall protein with type I and type II cysteine-rich repeats (antibody to first 786 amino acids, antibody)
  • cgd4_2720 (ATPase1) P-type ATpase involved in cation transport (polyclonal antibody directly to protein)
  • cgd7_4020 (GP900, gp900) cryptopsoridial mucin, large thr stretch, signal peptide sequence (monoclonal antibody directly to protein, monoclonal antibody, monoclonal antibody SA40)
  • cgd6_200 (COWP8) oocyst wall protein 8 (monoclonal antibody)
  • cgd4_690 (PNO) pyruvate:ferredoxin oxidoreductase/NADPH-cytochrome P450 reductase PNO (polyclonal antibody to AFSRDPKGYKTSN and KEFRERALNPTHPTLR)
  • cgd4_2330 (CP12) hypothetical protein (antibody)
  • cgd6_2330 (p30) hypothetical protein with signal peptide (polyclonal antibody to whole protein)