ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

Light microscopy using an antibody to an epitope tag

Plasmodium gallinaceum

  • AY775165 (Pg93) gi|58465290|gb|AY775165.1| Plasmodium gallinaceum Pg93 mRNA, partial cds (ANTIBODY TO GST TAG)

Plasmodium falciparum

  • PF10_0281 (MTRAP) merozoite TRAP-like protein (3' HA tag, 3' GFP tag, antibody, C terminal HA tag, polyclonal antibody directly to protein)
  • MAL7P1.27 (CRT) chloroquine resistance transporter (polyclonal antibody directly to protein, FLAG tag, polyclonal antibody directly to protein, antibody, GFP tag)
  • MAL7P1.231 (HRPII, hrp2, pfhrp2, hrpII) histidine-rich protein II (GFP, polyclonal antibody directly to protein, myc tag, Monoclonal antibody directly to protein, antibody)
  • PFD1120c (ETRAMP4, SEP4, Etramp 4, Etramp4) early transcribed membrane protein 4 (polyclonal antibody to myc tag and protein, polyclonal antibody directly to protein, myc tag, polyclonal antibody directly to protein, antibody)
  • PFB0120w (ETRAMP2, Etramp 2, Etramp2) early transcribed membrane protein 2 (polyclonal antibody directly to protein, myc tag, polyclonal antibody directly to protein, antibody)
  • PF10_0019 (ETRAMP10.1) early transcribed membrane protein 10.1 (polyclonal antibody directly to protein, myc tag, polyclonal antibody directly to protein)
  • PF14_0679 (SulP) inorganic anion exchanger, inorganic anion antiporter (HA tag)
  • PFE0370c (SUB1) subtilisin-like protease 1 (antibody, antibody, HA tag)
  • PFD1145c (Rh5, RH5) reticulocyte binding protein homologue 5 (C terminal HA tag, monoclonal antibody, antibody)
  • PFE0340c (Rom-4) rhomboid protease ROM4 (3' triple HA tag)
  • MAL7P1.119 (RALP1) rhoptry-associated leucine zipper-like protein 1 (GFP tag, C terminal Ty1 tag, antibody)
  • MAL13P1.206 (PiT) sodium-dependent phosphate transporter (HA tag)
  • PFI1370c (PSD) phosphatidylserine decarboxylase (FITC)
  • PF08_0012 (KMT1, SET3) SET domain protein, putative (C terminal HA tag, antibody directly to protein, antibody)
  • PFE0285c (SUMO) small ubiquitin-related modifier, putative (polyclonal antibody against epitopes QGEHIQVKVRSPDGA and YDGDRIHGDNTPEQL, FLAG tag)
  • PFF1130c (SOD2) superoxide dismutase (GFP tag, Ty tag, antibody, GFP tag)
  • PFE1510c (iTPT) triose phosphate transporter (C terminal HA tag, N terminal HA tag, YFP tag, antibody to epitope RNQPELFYDEQELKRINS)
  • PFB0680w (RON6) rhoptry neck protein 6 (3' HA tag, antibody)
  • PFF0730c (FabI) enoyl-acyl carrier reductase (V5 tag)
  • MAL13P1.310 (calpain) calpain (C terminal GFP, 2x flag tag, antibody to his tag, polyclonal antibody directly to protein)
  • MAL13P1.326 (FC, HemH) ferrochelatase (polyclonal antibody directly to protein, epitope tag, antibody directly to protein)
  • PFE1230c (Tom22) mitochondrial import receptor subunit tom22, putative (N terminal HA tag)
  • PFE1460w (Tic22) apicoplast TIC22 precursor (3' HA tag)
  • PF14_0498 (sDer1-1, Der1-Pl) DER1-like protein (C terminal GFP tag, 3' HA tag)
  • PF14_0065 (GAPM3) glideosome associated protein with multiple membrane spans 3, putative (HA tag)
  • PF14_0344 (PTEX150) translocon component PTEX150 (polyclonal antibody directly to protein, HA tag, antibody)
  • PF11_0175 (HSP101, ClpB2) heat shock protein 101 (polyclonal antibody directly to protein, HA tag, HA tag)
  • MAL13P1.130 (GAPM1) glideosome associated protein with multiple membrane spans 1 (HA tag, GFP tag, C terminal GFP tag)
  • PFL1410c (MRP2) ABC transporter, (CT family) (polyclonal antibody directly to protein epitope LHYEGNLVDYIKKNNIVVKEDIVQTNKQCEKKSLTNEQVKSMLSLNEDWNYMHRVKKKSITQKETTKNYD and GST)
  • PFL1005c (HP1, H1) heterochromatin protein 1 (antibody directly to protein, HA tag, Ty tag, GFP tag, Ty tag)
  • PF13_0133 (PM V, PM5, PMV) plasmepsin V (polyclonal antibody directly to protein, monoclonal antibody to residues 27-517, C terminal HA tag, antibody, YFP tag, GFP tag, antibody)
  • PFF0200c (SIP2) transcription factor with AP2 domain(s), putative,SPE2-interacting protein (HA tag)
  • MAL8P1.32 (NT2) nucleoside transporter 2 (Antibody to GFP tag, HA tag)
  • PFE0055c (PFE55) heat shock protein 40, type II (GFP, C terminal GFP tag, C terminal strep tag, C terminal mCherry tag)
  • PFA0660w (PFA660) heat shock protein 40, type II (C terminal GFP tag, C terminal strep tag)
  • PF08_0063 (ClpB1) ClpB protein, putative (HA tag)
  • PF14_0063 (ClpC) ATP-dependent Clp protease, putative (HA tag)
  • PFC0310c (ClpP) ATP-dependent Clp protease proteolytic subunit (GFP tag after N terminal region, antibody directly to protein, antibody to GFP tag, HA tag)
  • PF10_0168-b (GRASP, GRASP1) golgi re-assembly stacking protein 1 (GFP tag, polyclonal antibody directly to protein, GFP tag, C terminal GFP tag, HA tag)
  • PF14_0431 (CLK-1) protein serine/threonine kinase-1 (mouse antibody to epitope, myc tag)
  • PF14_0408 (SRPK2, CLK-2) serine/threonine protein kinase, putative (mouse antibody to epitope, myc tag)
  • PFF0860c (H2A) histone H2A (antibody, antibody to Ty tag)

Toxoplasma gondii

  • TGME49_088500 (FAD Malate-dehydrogenase (MDH-FAD)) malate:quinone oxidoreductase, putative (myc tag)
  • TGME49_067810 (Rab51, Rab5) Rab 5 (HA tag, antibody)
  • TGME49_055370 (Tic20) hypothetical protein (HA tag)
  • TGME49_033110 (IMPDH) inosine-5'-monophosphate dehydrogenase, putative (FLAG tag)
  • TGME49_088650 (GRA12) hypothetical protein (Ty tag)
  • TGME49_039740 (GRA14) hypothetical protein (antibody directly to protein, C terminal HA tag)
  • TGME49_061780 (MIC7) microneme protein 7 (Ty tag, polyclonal antibody directly to protein)
  • TGME49_045490 (MIC8, MIC9) microneme protein 8 (polyclonal antibody directly to protein, Ty tag, mCherry tag)
  • TGME49_116330 (SOD2, SODB2) iron-containing superoxide dismutase (C terminal Ty tag, Ty tag, GFP tag)
  • TGME49_054550 (GCN5) histone acetyltransferase GCN5 (FLAG tag, myc tag)
  • TGME49_005250 (ROP18) Rhoptry kinase family protein ROP18 (Ty tag)
  • TGME49_013900 (RCC1) regulator of chromosome condensation, putative (HA tag, N terminal FLAG tag)
  • TGME49_043440 (GCN5-B) histone acetyltransferase GCN5, putative (FLAG tag)
  • TGME49_006610 (PDH E2, PDHE2) biotin requiring domain-containing protein / 2-oxo acid dehydrogenases acyltransferase catalytic domain-containing protein (c terminal myc tag, polyclonal antibody directly to protein, Ty tag)
  • TGME49_027290 (HDAC3) histone deacetylase, putative (HA tag)
  • TGME49_109140 (TBL1) transducin beta-like protein 1 (TgTBL1) (HA tag)
  • TGME49_065450 (Hexokinase, HK) hexokinase (c terminal myc tag)
  • TGME49_083780 (GPI) glucose-6-phosphate isomerase (c terminal myc tag)
  • TGME49_026960 (Phosphofructokinase II, PFKII) phosphofructokinase, putative (c terminal myc tag)
  • TGME49_036040 (Aldolase I, aldolase, aldolase-1) fructose-1,6-bisphosphate aldolase (c terminal myc tag, c terminal myc tag, antibody directly to protein, antibody directly to protein)
  • TGME49_025930 (TPI I) triosephosphate isomerase, putative (c terminal myc tag)
  • TGME49_033500 (TPI II) triosephosphate isomerase, putative (c terminal myc tag)
  • TGME49_089690 (GAPDH I) glyceraldehyde-3-phosphate dehydrogenase (c terminal myc tag, C terminal myc tag)
  • TGME49_118230 (PGK I) phosphoglycerate kinase, putative (C terminal myc tag)
  • TGME49_022020 (PGK II) phosphoglycerate kinase, putative (c terminal myc tag)
  • TGME49_097060 (PGM II) phosphoglycerate mutase 1, putative (c terminal myc tag)
  • TGME49_068850 (ENO2) enolase 2 (c terminal myc tag, polyclonal antibody directly to protein, antibody, polyclonal antibody)
  • TGME49_068860 (ENO1) enolase 1 (c terminal myc tag, polyclonal antibody directly to protein)
  • TGME49_056760 (PK I, pyruvate kinase-1, PK1) pyruvate kinase, putative (c terminal myc tag, C terminal myc tag)
  • TGME49_099070 (PK II, PyKII) pyruvate kinase, putative (c terminal myc tag, polyclonal antibody directly to protein)
  • TGME49_045670 (PDH E1-alpha, PDHE1a) pyruvate dehydrogenase, putative (c terminal myc tag, Ty tag)
  • TGME49_072290 (PDH E1-beta, PDHE1b) pyruvate dehydrogenase E1 beta subunit, putative (c terminal myc tag, polyclonal antibody directly to protein, Ty tag)
  • TGME49_105980 (PDH E3 I) dihydrolipoyl dehydrogenase protein, putative (c terminal myc tag)
  • TGME49_006470 (PDH E3 II) dihydrolipoyl dehydrogenase, putative (c terminal myc tag)
  • TGME49_061070 (PT, APT1, APT) hypothetical protein (c terminal myc tag, HA tag)
  • TGME49_116190 (SOD3, SODB3) superoxide dismutase, putative (Ty tag, C terminal Ty tag)
  • TGME49_030410 (PRX3, Prx3) peroxiredoxin 3 (Ty tag, C terminal Ty tag)
  • TGME49_066120 (TPX1/1, TPX1/2) glutathione/thioredoxin peroxidase, putative (Ty tag)
  • TGME49_070120 (TLP1) thioredoxin, putative (Ty tag)
  • TGME49_026730 (ACN/IRP, Aconitase (ACN)) aconitate hydratase, putative (GFP tag, Ty tag, myc tag)
  • TGME49_066760 (ICDH1) isocitrate dehydrogenase, putative (Ty tag)
  • TGME49_068890 (CS1, Citrate-synthase I (CS1)) citrate synthase, putative (Ty tag, myc tag)
  • TGME49_013810 (IscA) iron-sulfur cluster assembly accessory protein, putative (Ty tag)
  • TGME49_037560 (IscU) nifU protein, putative (Ty tag)
  • TGME49_074060 (OMT) mitochondrial 2-oxoglutarate/malate carrier protein, putative (Ty tag)
  • TGME49_069190 (GAPDH2) glyceraldehyde-3-phosphate dehydrogenase (Ty tag)
  • TGME49_002810 (TIM14) DnaJ domain-containing protein (Ty tag)
  • TGME49_026400 (LipA) lipoic acid synthase (Ty tag, myc tag)
  • TGME49_110460 (Rab6) RAB6 protein (HA tag)
  • TGME49_035470 (MyoA) myosin A, putative (HA tag)
  • TGME49_000320 (HXGPRT-I, HXGPRT-II) hypoxanthine-xanthine-guanine phosphoribosyl transferase (epitope tag)
  • TGME49_014320 (GT1) facilitative glucose transporter, putative (C terminal myc tag, HA tag)
  • TGME49_032350 (lactate dehydrogenase-1, LDH1) lactate dehydrogenase (C terminal myc tag, polyclonal antibody directly to protein)
  • TGME49_018360 (ZFP1) zinc finger (CCCH type) protein, putative (YFP tag, HA tag)
  • TGME49_118430 (Malate-dehydrogenase (MDH)) malate dehydrogenase, putative (myc tag)
  • TGME49_000290 (ROM1) rhomboid family domain-containing protein (HA9 tag, HA tag, Ty tag, N-terminal myc tag)
  • TGME49_086150 PAN domain-containing protein (HA tag)
  • TGME49_005380 (Fructose-bisphosphatase I) fructose-1,6-bisphosphatase, putative (myc tag)
  • TGME49_047510 (Fructose-bisphosphatase II) fructose-1,6-bisphosphatase, putative (myc tag)
  • TGME49_085980 (glucosephosphate-mutase I, PRP1) phosphoglucomutase/parafusin related protein 1, putative (myc tag, polyclonal antibody directly to protein)
  • TGME49_118580 (glucosephosphate-mutase II) phosphoglucomutase, putative (myc tag)
  • TGME49_089650 (PEP-carboxykinase I) phosphoenolpyruvate carboxykinase (myc tag)
  • TGME49_113140 (ICDH2, Isocitrate-dehydrogenase I (IDH1)) isocitrate dehydrogenase, putative (myc tag)
  • TGME49_090600 (Succinyl-CoA-synthetase alpha (SCSa)) succinyl-CoA ligase alpha subunit, putative (myc tag)
  • TGME49_109750 (Succinyl-CoA-synthetase (ATP) (SCSb)) succinyl-CoA ligase, putative (myc tag)
  • TGME49_112110 (ATrx1) nucleoredoxin, putative (HA tag)
  • TGME49_059260 (FtsH1) cell division protein, putative (epitope tag)
  • TGME49_018850 (S9, rps9) ribosomal protein S9, putative (GFP tag, antibody directly to protein, GFP tag, HA tag)
  • TGME49_004130 (PLP1) membrane-attack complex / perforin domain-containing protein (HA tag, YFP tag)
  • TGME49_089770 (AP-1 u1 chain, µ1) mu1 adaptin (Ty tag, polyclonal antibody directly to protein, HA tag)
  • TGME49_067800 (DrpA) dynamin-like protein, putative (HA tag)
  • TGME49_086450 (GRA5) dense granule protein 5 precursor (monoclonal antibody to protein, antibody directly to protein, HA tag, monoclonal antibody directly to protein, polyclonal antibody directly to protein)
  • TGME49_001840 (ASP1) eukaryotic aspartyl protease, putative (myc tag, Ty tag, polyclonal antibody directly to protein)
  • TGME49_046550 (ASP3) eukaryotic aspartyl protease, putative (5' myc tag)
  • TGME49_042720 (ASP5) hypothetical protein (3' Ty tag)
  • TGME49_076140 (ADP ribosylation factor 1, ARF1) ADP ribosylation factor 1 (C terminal HA tag, polyclonal antibody directly to protein)
  • TGME49_063710 (ACAT1α, ACAT1β) sterol O-acyltransferase, putative (HA tag)
  • TGME49_061950 (ATP-B) ATP synthase beta chain, putative (myc tag)
  • TGME49_034570 (HAD-2SCP-2) peroxisomal multifunctional enzyme type 2, putative (HA tag, polyclonal antibody directly to protein)
  • TGME49_031850 (PP2C) serine-threonine phosophatase 2C (HA tag, polyclonal antibody directly to protein)
  • TGME49_111670 (TSA1) hypothetical protein (HA tag)
  • TGME49_009150 (NDH2-I) mitochondrial alternative NADH dehydrogenase 1 (myc tag)
  • TGME49_088830 (NDH2-II) pyridine nucleotide-disulphide oxidoreductase, putative (myc tag)
  • TGME49_068590 (ROM4) rhomboid-like protease 4 (HA tag, polyclonal antibody directly to protein, Ty tag, N-terminal myc tag)
  • TGME49_094690 (ROM5) rhomboid-like protease 5 (HA tag)
  • TGME49_001780 (MIC2, MIC 2) microneme protein 2 (Monoclonal antibody directly to protein, myc tag, monoclonal antibody directly to protein, antibody)
  • TGME49_063290 (ROM2) rhomboid-like protease TgROM2 (Ty tag, N-terminal myc tag)
  • TGME49_033480 (SRS2) SRS29C (= SRS2, P35) (polyclonal antibody directly to protein, MBP tag)
  • TGME49_108840 (SRS3) SRS51 (= SRS3) (MBP tag)
  • TGME49_057120 (ST1) glucose transporter, putative (C terminal Ty1 tag, N terminal HA tag, Ty1 tag in middle of protein)
  • TGME49_072500 (ST2) sugar transporter, putative (C terminal Ty1 tag, N terminal HA tag, Ty1 tag in middle of protein)
  • TGME49_001260 (ST3) sugar transporter, putative (C terminal Ty1 tag, N terminal HA tag, Ty1 tag in middle of protein)
  • TGME49_098990 (FNR) ferredoxin NADP+ oxidoreductase, putative (RFP tag, DsRed tag, YFP tag, HA tag)
  • TGME49_014080 (Toxofilin) toxofilin (His6 tagged, C terminal HA tag, polyclonal antibody to whole protein, N terminal GFP tag)
  • TGME49_094290 (Der1-1ER) der1-like family domain-containing protein, conserved (3xHA tag)
  • No assigned gene identifier (PRX, PRX1, 49.m03355, OPN, Der1-2ER, Der1Ap, RNG1) (polyclonal antibody directly to protein, YFP tag, monoclonal antibody to homologue, 3xHA tag, YFP tag, mCherry tag)
  • TGME49_121640 (Cdc48Ap) cell division protein 48, putative (cmyc tag, antibody)
  • TGME49_085700 (Ufd1Ap) hypothetical protein (3xHA tag)
  • TGME49_007690 (PDCD5) double-stranded DNA-binding domain-containing protein (Polyclonal antibody to whole protein, Cterminal HA tag, HA tag after 106 amino acids, Polyclonal antibody to whole protein)
  • TGME49_097520 (PPG1) hypothetical protein (C terminal HA tag, N terminal FLAG tag)
  • TGME49_090670 (LAP) cytosol aminopeptidase (Monoclonal antibody to HA tag, polyclonal antibody to whole protein)
  • TGME49_017460 (GlnRS) glutaminyl-tRNA synthetase, putative (Ty tag)
  • TGME49_099810 (CysRS) cysteinyl-tRNA synthetase, putative (Ty tag)
  • TGME49_019850 (ProRS) prolyl-tRNA synthetase, putative (Ty tag)
  • TGME49_066730 (LeuRS2) leucyl-tRNA synthetase, putative (Ty tag)
  • TGME49_071730 (SerRS2) seryl-tRNA synthetase, putative (Ty tag)
  • TGME49_015450 (AQP1) aquaporin (antibody against LGYVGTHAYHNPVPLRFLNFRGL, C terminal myc tag)
  • TGME49_048880 (Rab7) Ras family domain-containing protein (N terminal HA tag)
  • TGME49_110160 (-AGO) piwi-PAZ domain-containing protein (HA tag)
  • TGME49_044270 (ABCG87) ABC transporter, putative (antibody to HA tag)
  • TGME49_089630 (MIC16) hypothetical protein (YFP tag, antibody to Ty tag)
  • TGME49_120480 (Rab11B) Rab 11b, putative (N terminal myc tag)
  • TGME49_037820 (ISP2) hypothetical protein (C terminal HA tag)
  • TGME49_116540 (ISP3) hypothetical protein (C terminal HA tag)
  • TGME49_057680 (MLC1) myosin light chain TgMLC1 (polyclonal antibody directly to protein, monospecific antibody directly to protein, YFP tag, Ty tag)
  • TGME49_049850 (GAP40) hypothetical protein, conserved (Ty tag)
  • TGME49_033030 (GAP70) myosin-A docking protein, putative (Ty tag)
  • TGME49_109250 (AT-hook 056400) AT hook motif-containing protein (HA tag)
  • TGME49_025410 (CenH3, CenpA) histone H3 variant, putative (antibody to YFP tag, HA tag)
  • TGME49_016600 (APE) DNA-(apurinic or apyrimidinic site) lyase, putative (antibody directly to protein, FLAG tag)
  • TGME49_088680 (APN) endonuclease V, putative (antibody directly to protein, FLAG tag)
  • TGME49_106060 (RON8) hypothetical protein (antibody directly to protein, antibody against His6 tagged protein, polyclonal antibody directly to protein, 3HA tag)
  • TGME49_029010 (RON4) hypothetical protein (Monoclonal antibody directly to protein, antibody directly to protein, polyclonal antibody directly to protein, antibody, antibody, HA tag)
  • TGME49_007900 (ORF25.m01787) transcription factor IIIB subunit, putative (antibody, 3HA tag)
  • TGME49_048340 (Ran) GTP-binding nuclear protein RAN/TC4, putative (C terminal FLAG tag)
  • TGME49_098630 (VTC2) SPX domain-containing protein (HA tag)
  • TGME49_060440 (NF3) 46 kDa FK506-binding nuclear protein, putative (YFP tag, HAFLAG ta)
  • TGME49_005580 (NF4) hypothetical protein (YFP tag, HAFLAG tag)
  • TGME49_105180 (NHE3) sodium/hydrogen exchanger, putative (antibody to residues 917-116, HA tag)

Plasmodium berghei

  • PBANKA_144400 (MIF) macrophage migration inhibitory factor (C terminal myc tag, C terminal GFP tag)
  • PBANKA_103820 (MISFIT) nuclear formin-like protein (myc tag)
  • PBANKA_030490 (SERA3) serine repeat antigen 3 (TAP tag)

Plasmodium yoelii

  • PY04986 (USO3) 250-270 copies of a 13 AA repeat, NSSTPITSSSIL (C terminal myc tag)
  • PY00819 (PDH E1a) pyruvate dehydrogenase E1 alpha subunit (myc tag)
  • PY00573 (PDH E3) dihydrolipoamide dehydrogenase (myc tag)
  • PY03846 (FabI) enoyl-acyl carrier reductase (antibody, myc tag)