ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_121620 (DrpB)

dynamin-like protein, putative, a gene from Toxoplasma gondii

Compiled localisation
cytoplasmic region close to the golgi during after assembly of tachyzoite daughter cells
cytoplasmic foci during tachyzoite

Who localised this protein by microscopy?

Parussini, F., Coppens, I., Shah, P. P., Diamond, S. L., Carruthers, V. B.
Cathepsin L occupies a vacuolar compartment and is a protein maturase within the endo/exocytic system of Toxoplasma gondii. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

cytoplasmic foci during tachyzoite

Breinich, M. S., Ferguson, D. J., Foth, B. J., van Dooren, G. G., Lebrun, M., Quon, D. V., Striepen, B., Bradley, P. J., Frischknecht, F., Carruthers, V. B., Meissner, M.
A dynamin is required for the biogenesis of secretory organelles in Toxoplasma gondii. (2009 Feb 24, Curr Biol) PubMed / full text
   more detail about this publication

cytoplasmic region close to the golgi during after assembly of tachyzoite daughter cells

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10138

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_121620 dynamin-like protein, putative
MDGKREDVSARPPAVSAPGDGEKSMTNGVKVESQMYQQLRKLINVVDELRDVGLQQFIQLPRICVVGTQSAGKSSVLEAI
VGLDFLPRGDGVVTRRPLELRLVHLSEAEHDLNEAYAVFENDKERKIRDFEQVRQEIDRLTDQVAGKNKGIIDSPIVLTI
YATQCPDLSLIDLPGITRVPLKGSDQCEDIEMLTRQMALRYASDPRTIILAVIPANVDMSTSDALQMSRRVDPRGVRTIG
VITKIDLMDRGTDAAKMLMGEEIPLRLGYTGVRNRSQADIREGKSVRECLEEEKTFFATHPTYRLLPPHLVGVHSLVDKL
TKVLFRHIKNFLPEIKREISSKTRVVLDRLQELGEGVPMEPSERAQLLWTAITDYVEIFKNTIRGKYDKRLQMYFEHQKD
ITGGSQIRTIFNELLEEFNDRKVTEDISDYEIDVAIRLHEGDSLPGFPSPDTFEYLILPYLKRIQAPVIECLDRVSQTLE
LLSQKIANRVFGRFPALAEKVLELSQEILIRERDHTKVILQQIVDAETGYLFTNDAKYLSEHGSMISQESPDVAQGAFPQ
QGQGQVQLYGADGRPVQLGPDGKPVPPPTHAERAQQMLSSMQQSVTTIWSQNSREKKKTVYSEQFIREIRRRLDSYFALV
LRNVRDSVPKTIGFFLVRQLQEKLQFELYNQLNDETQFSALLGEPPHIMEERRALMSQLQTLKRASAVLQRDPTIAALNL
DTVDENFDRDLRELQRDAGTRALPNLQSFSSFGSGEGRGQPIAGGMQRPDAHSAYLGGSQRANGVAASAAAPTTPGQNVS
DPGSFSPATGGLVAAGSLPDKARALSSSGVFDSKGASASAAKHVFEKVKFQAANNPLFSD

Gene-Specific Links for TGME49_121620

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins