ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_121570 (FABZ)

(3R)-hydroxymyristoyl ACP dehydrase, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during bradyzoite and tachyzoite

Who localised this protein by microscopy?

Dautu, G., Ueno, A., Munyaka, B., Carmen, G., Makino, S., Kobayashi, Y., Igarashi, M.
Molecular and biochemical characterization of Toxoplasma gondii beta-hydroxyacyl-acyl carrier protein dehydratase (FABZ). (2008 May, Parasitol Res) PubMed / full text
   more detail about this publication

apicoplast during bradyzoite and tachyzoite
  • "Indirect immunofluorescence antibody test further shows the localization of TgFABZ protein in the apicoplast of both tachyzoites and bradyzoites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Beverley
  • Gene model mapping comments: annotation searched and FabZ is the proposed gene name according to ToxoDB 5.0
  • Localisation record: apicoplast during tachyzoite and bradyzoite
  • Other genes localised in this publication: acyl carrier protein, bradyzoite antigen, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13556

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF13_0128 beta-hydroxyacyl-ACP dehydratase precursor
  • PBANKA_133820 beta-hydroxyacyl-ACP dehydratase precursor, putative
  • PY01586 beta-hydroxyacyl-ACP dehydratase precursor
  • PVX_116720 beta-hydroxyacyl-ACP dehydratase precursor, putative
  • PCHAS_134280 beta-hydroxyacyl-ACP dehydratase precursor, putative
  • PKH_123010 beta-hydroxyacyl-ACP dehydratase precursor, putative
  • NCLIV_004340 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_121570 (3R)-hydroxymyristoyl ACP dehydrase, putative
MENLILFVAVCVLSLICRSEAFTVGPGSRFCAGQSGLAGSVLPGCSAHAGRGISTSRLDPPSVTSLSSAWRGAKEISGLT
ESTANPVFDVEKIREILPHRFPFLLVDKVLEFEPGKRAVGVKQISANEDQFNGHFPHRAILPGVLQVEALAQLAGIVALQ
PPISNGQGNFFFAGVDGVKWKKPVVPGDTLVMEVELTAWKEKFGIAKATGKAFVDGKPAIEVGEMTFALVR

Gene-Specific Links for TGME49_121570

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins