ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_121530 (CPL)

cathepsin L-like thiolproteinase, putative, a gene from Toxoplasma gondii

Compiled localisation
apical during extracellular tachyzoite and shortly after invasion of tachyzoite and tachyzoite
lysosome and multi-vesicular endosome
posterior to nucleus and rhoptry during extracellular tachyzoite and intracellular tachyzoite
vacuole during extracellular tachyzoite
plant-like vacuole during extracellular tachyzoite and intracellular tachyzoite and tachyzoites undergoing intracellular replication

Who localised this protein by microscopy?

Francia, M. E., Wicher, S., Pace, D. A., Sullivan, J., Moreno, S. N., Arrizabalaga, G.
A Toxoplasma gondii protein with homology to intracellular type Na/H exchangers is important for osmoregulation and invasion. (2011 Jun 10, Exp Cell Res) PubMed / full text
   more detail about this publication

plant-like vacuole during extracellular tachyzoite and intracellular tachyzoite
  • "TgVP1 has been shown to partly co-localize with a cathepsin l protease (TgCPL) to the PLV/VAC [14] and [15]."
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: RH HPT-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PLV/VAC during intracellular tachyzoite and extracellular tachyzoite
  • Other genes localised in this publication: sodium/hydrogen exchanger, putative, H+-translocating inorganic pyrophosphatase TVP, putative

Rooney, P. J., Ayong, L., Tobin, C. M., Moreno, S. N., Knoll, L. J.
TgVTC2 is involved in polyphosphate accumulation in Toxoplasma gondii. (2011 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

plant-like vacuole during extracellular tachyzoite

Parussini, F., Coppens, I., Shah, P. P., Diamond, S. L., Carruthers, V. B.
Cathepsin L occupies a vacuolar compartment and is a protein maturase within the endo/exocytic system of Toxoplasma gondii. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

apical during extracellular tachyzoite and shortly after invasion of tachyzoite, plant-like vacuole during tachyzoites undergoing intracellular replication

Miranda, K., Pace, D. A., Cintron, R., Rodrigues, J. C., Fang, J., Smith, A., Rohloff, P., Coelho, E., de Haas, F., de Souza, W., Coppens, I., Sibley, L. D., Moreno, S. N.
Characterization of a novel organelle in Toxoplasma gondii with similar composition and function to the plant vacuole. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

vacuole during extracellular tachyzoite
  • "As shown in Fig. 3A, TgVP1 and TgCPL show co-localization to the same organelle with TgCPL occupying the interior of a large vacuole while antibodies against TgVP1 labeled its membrane"
  • Microscopy type: light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: taken directly from publication
  • Localisation record: vacuole during extracellular tachyzoite
  • Other genes localised in this publication: H+-translocating inorganic pyrophosphatase TVP, putative, aquaporin

Larson, E. T., Parussini, F., Huynh, M. H., Giebel, J. D., Kelley, A. M., Zhang, L., Bogyo, M., Merritt, E. A., Carruthers, V. B.
Toxoplasma gondii cathepsin L is the primary target of the invasion-inhibitory compound morpholinurea-leucyl-homophenyl-vinyl sulfone phenyl. (2009 Sep 25, J Biol Chem) PubMed / full text
   more detail about this publication

posterior to nucleus and rhoptry during extracellular tachyzoite and intracellular tachyzoite
  • "As shown by fluorescently-labeled LHVS and TgCPL-specific antibodies, TgCPL is associated with a discrete vesicular structure in the apical region of extracellular parasites, but is found in multiple puncta throughout the cytoplasm of intracellular replicating parasites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from DQ407191, annotation matches
  • Localisation record: rhoptry and posterior to nucleus during intracellular tachyzoite and extracellular tachyzoite
  • Other genes localised in this publication: -

Huynh, M. H., Carruthers, V. B.
Tagging of endogenous genes in a Toxoplasma gondii strain lacking Ku80. (2009 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

lysosome and multi-vesicular endosome

Huang, R., Que, X., Hirata, K., Brinen, L. S., Lee, J. H., Hansell, E., Engel, J., Sajid, M., Reed, S.
The cathepsin L of Toxoplasma gondii (TgCPL) and its endogenous macromolecular inhibitor, toxostatin. (2009 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical during tachyzoite
  • "TgCPL was found primarily in the apical end of the tachyzoite (Fig. 6A), but did not co-localize with any apical organelles, including rhoptries, dense granules, or micronemes (data not shown)."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AF184984
  • Localisation record: apical during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10073

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_121530 cathepsin L-like thiolproteinase, putative
MDSSETHYVSFLNGEDDGLENGELHQRRGVRAGRPSPPFVVTTRTYFWKKFLRQRNFTARAWIALVAAAVSLLVFASFLI
QWQGEDDRAVFPPSPVEDHQPPANIWEWKEAHFQDAFSSFQAMYAKSYATEEEKQRRYAIFKNNLVYIHTHNQQGYSYSL
KMNHFGDLSRDEFRRKYLGFKKSRNLKSHHLGVATELLNVLPSELPAGVDWRSRGCVTPVKDQRDCGSCWAFSTTGALEG
AHCAKTGKLVSLSEQELMDCSRAEGNQSCSGGEMNDAFQYVLDSGGICSEDAYPYLARDEECRAQSCEKVVKILGFKDVP
RRSEAAMKAALAKSPVSIAIEADQMPFQFYHEGVFDASCGTDLDHGVLLVGYGTDKESKKDFWIMKNSWGTGWGRDGYMY
MAMHKGEEGQCGLLLDASFPVM

Gene-Specific Links for TGME49_121530

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins