TGME49_121530 (CPL)
cathepsin L-like thiolproteinase, putative, a
gene from Toxoplasma gondii
Compiled localisation
apical during extracellular tachyzoite and shortly after invasion of tachyzoite and tachyzoite
lysosome and multi-vesicular endosome
posterior to nucleus and rhoptry during extracellular tachyzoite and intracellular tachyzoite
vacuole during extracellular tachyzoite
plant-like vacuole during extracellular tachyzoite and intracellular tachyzoite and tachyzoites undergoing intracellular replication
Who localised this protein by microscopy?
Francia, M. E., Wicher, S., Pace, D. A., Sullivan, J., Moreno, S. N., Arrizabalaga, G. A Toxoplasma gondii protein with homology to intracellular type Na/H exchangers is important for osmoregulation and invasion. (2011 Jun 10, Exp Cell Res)
PubMed /
full text
   more detail about this publication
plant-like vacuole during extracellular tachyzoite and intracellular tachyzoite
-
"TgVP1 has been shown to partly co-localize with a cathepsin l protease (TgCPL) to the PLV/VAC [14] and [15]."
-
Microscopy type: fixed light
-
Microscopy method: antibody
-
Strain: RH HPT-
-
Gene model mapping comments: inferred from another publication
-
Localisation record: PLV/VAC during intracellular tachyzoite and extracellular tachyzoite
- Other genes localised in this publication:
sodium/hydrogen exchanger, putative, H+-translocating inorganic pyrophosphatase TVP, putative
Rooney, P. J., Ayong, L., Tobin, C. M., Moreno, S. N., Knoll, L. J. TgVTC2 is involved in polyphosphate accumulation in Toxoplasma gondii. (2011 Apr, Mol Biochem Parasitol)
PubMed /
full text
   more detail about this publication
plant-like vacuole during extracellular tachyzoite
Parussini, F., Coppens, I., Shah, P. P., Diamond, S. L., Carruthers, V. B. Cathepsin L occupies a vacuolar compartment and is a protein maturase within the endo/exocytic system of Toxoplasma gondii. (2010 Jun, Mol Microbiol)
PubMed /
full text
   more detail about this publication
apical during extracellular tachyzoite and shortly after invasion of tachyzoite, plant-like vacuole during tachyzoites undergoing intracellular replication
-
"TgCPL localization in formaldehyde fixed RH parasites by immunofluorescence using MαTgCPL showing that TgCPL occupies a single apical localization in extracellular (i) and newly invaded parasites (ii). In contrast, TgCPL showed a punctate distribution in tachyzoites undergoing intracellular replication (iii)."
-
Microscopy type: light, EM
-
Microscopy method: monoclonal antibody against LARDEECRAQSCEKVV
-
Strain: RH
-
Gene model mapping comments: inferred from another publication
-
Localisation record: apical during extracellular tachyzoite and newly invaded tachyzoite, vac during tachyzoites undergoing intracellular replication
-
Comment: vac is an acronym for vacuolar compartment
- Other genes localised in this publication:
Rhoptry kinase family protein ROP2A (incomplete catalytic triad), Rhoptry kinase family protein ROP4 / ROP7 (incomplete catalytic triad) ***WARNING: GENE MODEL INACCURATE ***, gorasp2-prov protein, dynamin-like protein, putative, apical membrane antigen 1, putative, Rab 5, H+-translocating inorganic pyrophosphatase TVP, putative, Ras family domain-containing protein, MIC2-associated protein M2AP, caltractin, putative
Miranda, K., Pace, D. A., Cintron, R., Rodrigues, J. C., Fang, J., Smith, A., Rohloff, P., Coelho, E., de Haas, F., de Souza, W., Coppens, I., Sibley, L. D., Moreno, S. N. Characterization of a novel organelle in Toxoplasma gondii with similar composition and function to the plant vacuole. (2010 Jun, Mol Microbiol)
PubMed /
full text
   more detail about this publication
vacuole during extracellular tachyzoite
-
"As shown in Fig. 3A, TgVP1 and TgCPL show co-localization to the same organelle with TgCPL occupying the interior of a large vacuole while antibodies against TgVP1 labeled its membrane"
-
Microscopy type: light
-
Microscopy method: antibody
-
Strain: RH
-
Gene model mapping comments: taken directly from publication
-
Localisation record: vacuole during extracellular tachyzoite
- Other genes localised in this publication:
H+-translocating inorganic pyrophosphatase TVP, putative, aquaporin
Larson, E. T., Parussini, F., Huynh, M. H., Giebel, J. D., Kelley, A. M., Zhang, L., Bogyo, M., Merritt, E. A., Carruthers, V. B. Toxoplasma gondii cathepsin L is the primary target of the invasion-inhibitory compound morpholinurea-leucyl-homophenyl-vinyl sulfone phenyl. (2009 Sep 25, J Biol Chem)
PubMed /
full text
   more detail about this publication
posterior to nucleus and rhoptry during extracellular tachyzoite and intracellular tachyzoite
-
"As shown by fluorescently-labeled LHVS and TgCPL-specific antibodies, TgCPL is associated with a discrete vesicular structure in the apical region of extracellular parasites, but is found in multiple puncta throughout the cytoplasm of intracellular replicating parasites."
-
Microscopy type: Light
-
Microscopy method: polyclonal antibody directly to protein
-
Strain: RH
-
Gene model mapping comments: Blast from DQ407191, annotation matches
-
Localisation record: rhoptry and posterior to nucleus during intracellular tachyzoite and extracellular tachyzoite
- Other genes localised in this publication:
-
Huynh, M. H., Carruthers, V. B. Tagging of endogenous genes in a Toxoplasma gondii strain lacking Ku80. (2009 Apr, Eukaryot Cell)
PubMed /
full text
   more detail about this publication
lysosome and multi-vesicular endosome
-
"Table 1"
-
Microscopy type: Light
-
Microscopy method: YFP tag
-
Strain: RHKu80-
-
Gene model mapping comments: taken directly from 19218426
-
Localisation record: Multi-vesicular endosome and lysosome
- Other genes localised in this publication:
acyl carrier protein, proliferating cell nuclear antigen 1, rhoptry protein, putative, microneme protein MIC3, membrane-attack complex / perforin domain-containing protein, microneme TgMIC5 protein, MIC2-associated protein M2AP, heat shock protein 60, membrane skeletal protein IMC1, SRS29B (= SAG1, P30), chitinase class I, putative, hypothetical protein, hypothetical protein, peptidase M16 domain containing protein, hypothetical protein, microneme protein, putative, A common gene for all genes not assigned to a gene model, non-transmembrane antigen, C2 domain-containing protein, cysteine proteinase, putative
Huang, R., Que, X., Hirata, K., Brinen, L. S., Lee, J. H., Hansell, E., Engel, J., Sajid, M., Reed, S. The cathepsin L of Toxoplasma gondii (TgCPL) and its endogenous macromolecular inhibitor, toxostatin. (2009 Mar, Mol Biochem Parasitol)
PubMed /
full text
   more detail about this publication
apical during tachyzoite
-
"TgCPL was found primarily in the apical end of the tachyzoite (Fig. 6A), but did not co-localize with any apical organelles, including rhoptries, dense granules, or micronemes (data not shown)."
-
Microscopy type: Light, EM
-
Microscopy method: polyclonal antibody directly to protein
-
Strain: RH
-
Gene model mapping comments: Blast from AF184984
-
Localisation record: apical during tachyzoite
- Other genes localised in this publication:
-
Orthology
OrthoMCL
Part of OrthoMCL group OG4_10073
Localised Genes in this Group
-
PF11_0165 (Falcipain-2, FP2): cytoplasmic vesicle and endoplasmic reticulum and golgi apparatus during trophozoite, food vacuole during early schizont and early trophozoite and late schizont and late trophozoite and trophozoite, during not early ring and not late ring
-
PVX_091405 (VX-4): cytoplasm and food vacuole during erythrocytic
-
TGME49_121530 (CPL): apical during extracellular tachyzoite and shortly after invasion of tachyzoite and tachyzoite, lysosome and multi-vesicular endosome, posterior to nucleus and rhoptry during extracellular tachyzoite and intracellular tachyzoite, vacuole during extracellular tachyzoite, plant-like vacuole during extracellular tachyzoite and intracellular tachyzoite and tachyzoites undergoing intracellular replication
-
PF11_0162 (Falcipain-3, FP3): food vacuole during early schizont and early trophozoite and late schizont and late trophozoite and trophozoite, during not early ring and not late ring, erythrocyte cytoplasm during gametocyte, vesicle under erythrocyte surface during gametocyte stage iv
Other Apicomplexan Genes in this Group
-
PKH_091250 P.knowlesi ortholog of falcipain
-
PKH_091240 P.knowlesi ortholog of falcipain
-
TA03745 cysteine proteinase precursor, tacP, putative
-
PY00783 berghepain-2
-
PCHAS_091190 chabaupain 2
-
PBANKA_093240 berghepain-2
-
CMU_021330 papain family cysteine protease, putative
-
TA03740 cysteine proteinase precursor, tacP, putative
-
PVX_091415 (VX-2) vivapain-2
-
NCLIV_004380 Cathepsin L, related
-
TP02_0099 cysteine protease, putative
-
TP02_0097 cysteine protease, putative
-
TA03750 cysteine proteinase precursor, tacP, putative
-
TP02_0098 cysteine protease, putative
-
TA03735 cysteine protease precursor, tacP, putative
-
PF11_0161 cysteine proteinase falcipain 2b
-
cgd6_4880 cryptopain - cysteine proteinase secreted, possible transmembrane domain near N-terminus
-
PKH_091260 P.knowlesi ortholog of falcipain
-
TA03730 cysteine proteinase precursor, tacP, putative
-
Chro.60563 cryptopain precursor
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
-
Arabidopsis thaliana- Q9LM66: cell wall
-
Arabidopsis thaliana- P43297: vacuole, chloroplast, apoplast
-
Arabidopsis thaliana- Q9SUL1: vacuole
-
Arabidopsis thaliana- P43296: nucleus, vacuole
-
Arabidopsis thaliana- Q9FMH8: vacuole, cytosol
-
Arabidopsis thaliana- Q9FJ47: senescence-associated vacuole
-
Caenorhabditis elegans- O45734: vesicle lumen, yolk granule
-
Dictyostelium discoideum- Q54F16: extracellular space
-
Dictyostelium discoideum- P54639: extracellular space
-
Dictyostelium discoideum- P54640: extracellular space
-
Dictyostelium discoideum- Q94503: extracellular space
-
Dictyostelium discoideum- Q94504: extracellular space
-
Drosophila melanogaster- Q9VN93: fusome
-
Drosophila melanogaster- Q95029: fusome
-
Mus musculus- Q3UD32: lysosome, membrane
-
Rattus norvegicus- P07154: soluble fraction, lysosome, microvillus, external side of plasma membrane, neuron projection, perikaryon
-
Rattus norvegicus- O35186: extracellular space, lysosome
Amino Acid Sequence
>TGME49_121530 cathepsin L-like thiolproteinase, putative
MDSSETHYVSFLNGEDDGLENGELHQRRGVRAGRPSPPFVVTTRTYFWKKFLRQRNFTARAWIALVAAAVSLLVFASFLI QWQGEDDRAVFPPSPVEDHQPPANIWEWKEAHFQDAFSSFQAMYAKSYATEEEKQRRYAIFKNNLVYIHTHNQQGYSYSL KMNHFGDLSRDEFRRKYLGFKKSRNLKSHHLGVATELLNVLPSELPAGVDWRSRGCVTPVKDQRDCGSCWAFSTTGALEG AHCAKTGKLVSLSEQELMDCSRAEGNQSCSGGEMNDAFQYVLDSGGICSEDAYPYLARDEECRAQSCEKVVKILGFKDVP RRSEAAMKAALAKSPVSIAIEADQMPFQFYHEGVFDASCGTDLDHGVLLVGYGTDKESKKDFWIMKNSWGTGWGRDGYMY MAMHKGEEGQCGLLLDASFPVM
Proteomics
Found in:
Not found in:
Gene-Specific Links for TGME49_121530
General Sub-Cellular Localisation Links
-
TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
-
OrthoMCL, automatic clustering of orthologous groups of proteins
|