ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_121520 (-p23)

P23 co-chaperone, putative, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm and not nucleus during tachyzoite
cytosol and nucleus during bradyzoite

Who localised this protein by microscopy?

Echeverria, P. C., Figueras, M. J., Vogler, M., Kriehuber, T., de Miguel, N., Deng, B., Dalmasso, M. C., Matthews, D. E., Matrajt, M., Haslbeck, M., Buchner, J., Angel, S. O.
The Hsp90 co-chaperone p23 of Toxoplasma gondii: Identification, functional analysis and dynamic interactome determination. (2010 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and not nucleus during tachyzoite, cytosol and nucleus during bradyzoite
  • "For p23, a cytoplasmic localization was observed in tachyzoite samples whereas in bradyzoites both, a cytosolic and nuclear distribution was observed."
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: PK
  • Gene model mapping comments: taken directly from publication
  • Localisation record: cytoplasm and not nucleus during tachyzoite, cytosol and nucleus during bradyzoite
  • Other genes localised in this publication: heat shock protein 90, 58 kDa phosphoprotein, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10884

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_121520 P23 co-chaperone, putative
MADAQVHSPQCAWAETKEFIFLTVQVQSPEDLQVNLQESSLDFKCTSDKKAFAFHLDFPHPIIVEDSKYSVQRNVQFKLV
KKEKERWRTLSGKTKLHWLKCDWDKWIDSDDEDAKGMDMGDFDMNSMDFGGMGGLGGMGGLGGMGGMGGLGGMGGMGDMD
FGDMGDMDSDDEDDLHDLDDSMQKEDEHEHEGGCCGGHGKECEGEKAEEHKVNGVEGTTPAEAAQA

Gene-Specific Links for TGME49_121520

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins