ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_121400 ()

microsomal signal peptidase subunit SPCS1 domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12858

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0317 microsomal signal peptidase protein, putative
  • PBANKA_101130 nicrosomal signal peptidase, putative
  • PY06001 signal peptidase 12kDa subunit
  • PVX_084850 microsomal signal peptidase 12 kDa subunit, putative
  • PCHAS_101210 nicrosomal signal peptidase, putative
  • PKH_131570 microsomal signal peptidase 12 kDa subunit, putative
  • TGME49_121400 microsomal signal peptidase subunit SPCS1 domain-containing protein
  • NCLIV_004530 microsomal signal peptidase subunit SPCS1 domain- containing protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_121400 microsomal signal peptidase subunit SPCS1 domain-containing protein
MGISSCGETLASCFKAVKSGTVDFKGQERVYSWLIYFAWAGGLSGFFVGGILEDFTVTVYTILMCMAIAAILCFPSWPCF
HRHPVEWTPHDPARLAALFTQHQTQEETPQKGAGKKRGKKSAEVKRKN

Gene-Specific Links for TGME49_121400

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins