ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_120480 (Rab11B)

Rab 11b, putative, a gene from Toxoplasma gondii

Compiled localisation
golgi apparatus and not inner membrane complex during after tachyzoite cell division and early tachyzoite cell division
inner membrane complex and not golgi apparatus during tachyzoite cell division

Who localised this protein by microscopy?

Agop-Nersesian, C., Egarter, S., Langsley, G., Foth, B. J., Ferguson, D. J., Meissner, M.
Biogenesis of the inner membrane complex is dependent on vesicular transport by the alveolate specific GTPase Rab11B. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

golgi apparatus and not inner membrane complex during after tachyzoite cell division and early tachyzoite cell division, inner membrane complex and not golgi apparatus during tachyzoite cell division
  • "Rab11B localises to the Golgi at the initial phase of cell division (upper panel and inlet) and accumulates to the nascent IMC of daughter parasites during endodyogeny (see A,C middle panel). After endodyogeny is completed Rab11B again accumulates at the Golgi (lower panel and inlet)."
  • Microscopy type: light, EM
  • Microscopy method: N terminal myc tag
  • Strain: RH
  • Gene model mapping comments: OrthoMCL group OG4_21991 taken directly from paper, there is only 1 T. gondii gene in this group – TGME49_120480
  • Localisation record: golgi and not inner membrane complex during initial stage of cell division and after endodyogeny, inner membrane complex and not golgi during endodyogeny
  • Other genes localised in this publication: membrane skeletal protein IMC1, gorasp2-prov protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_21991

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_120480 Rab 11b, putative
MAGGSEDYDHLYKVILVGDATVGKTHLLSRYIRGTLPKSPKATIGVEFATRTVPLAVGGTVKAQIWDTAGQERYRSITSA
HYRRAVGALLVYDVTRKSTFLNASKWLEELRQNSEPDIVIMMVGNKLDLVEKDPTARDVPYELAAKFAQANGLYFSEASA
VTAFNVKHIFEHLLQEIYNHRTQGEEFSGRANGADAYRDAQALGGVRLAANANMYGRNPQNLSCCG

Gene-Specific Links for TGME49_120480

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins