ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_120300 ()

SNF2 family N-terminal domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11015

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFB0730w DEAD/DEAH box helicase, putative
  • PBANKA_031270 DEAD/DEAH helicase, putative
  • PY01120 Arabidopsis thaliana BRAHMA ortholog-related
  • PVX_002740 helicase, putative
  • PCHAS_031480 DEAD/DEAH helicase, putative
  • PKH_040400 DNA helicase, putative
  • TGME49_078440 transcription regulatory protein SNF2, putative
  • TGME49_120300 SNF2 family N-terminal domain-containing protein
  • NCLIV_009850 SNF2 family N-terminal domain-containing protein (EC 2.7.11.1), related
  • NCLIV_067550 hypothetical protein
  • cgd2_3700 SWI/SNF related putative transcriptional regulator ATpase
  • cgd8_2300 brahma like protein with a HSA domain, SNF2 like helicase and a bromo domain
  • Chro.20395 SNF2 domain/helicase domain-containing protein
  • CMU_003700 SNF2 family helicase, putative
  • CMU_026280 transcription regulatory protein SNF2, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_120300 SNF2 family N-terminal domain-containing protein
MEGGGPVAVSPSARPEVSSKNRVASASSRLDTDGPLSDFLEQQNAFFSHLHTDSASSHVEAAINGDCSVTSPLPALPSLS
TVPPPSHADLASPPPLLSPGKENGIFGDPRDPFANLFSNSSSFSSSSASSASSSSASCEHSGDDDDSILSSSEIREQLRL
QLAAARYVQQGAVPPAEILFRIHQALPKRERRKWRDANGRAARPAVTHILQKIRQGSRQEAFEQLEERRRLLDGLLDGKN
RELYEQFCCFPESVRVQATLERRLHSLARFQESLRSAVVEEGRRTLAPPSALLLRPQVPRSLHERAFLCLCSCAGCCRKS
HPVSERLLASSLADASSSQRKSDVVALHTKRENAPCCGCCCFGFCRGCVSRAAGAGAAASRPGEKKSGRKDDDEKREKGK
RRATLAWPAASGCGVFDALGHVSGDDAWRRGPTGYLQRLAIKARHRTLSAVQQVYAAVQARPCPALQPPLRQQQQRRRLW
HQAAAQVRSMEMREEWREKRAVAKRLAATAASQVAAIKQKQQQLREKAQKERMRLLKENDMASYMKLVEDTKNARLRELL
AATDAFLTDLSVKVRAQQVATKDLARQHQMSEDRRKQTDDLGDGEAAFGDAHKGSGEAQKGGNEVEKIDKTDEKTEETEK
KEEREKKEKKEDDAQNSSGSWALGQDQYYAMSHQVQEEVQQPSTLTGGDLMPYQMAGLSWMLSLYNNDLHGILADEMGLG
KTIQTIALLAYLKEFKNNSGPHLIIAPLSTLPNWADEFRRWCPSLKVVVLKGGRLERRELQRELRRGDFNVCLTTFDLAM
RERHGLSFPNWRHLVVDEGHRMKNSKSKFHICVSEFRATHRLLLTGTPLQNNLAELWSLLNFLLPKIFSCASDFEKWFSQ
PFEGQGMPVEGGDPDGAGTAFLNEEERLLIINRLHAVLRPFLLRRVKKDVLKDMPERKEYLVRICLSAWQQAVYKQIQEK
GLRTVDQVGHVTKRGFQNTLMQLRKIANHPYLFVDEYLVNEDLVRVAGKFECLDRMLPKLLHFKHKVLIFSQMTQVLDLM
AEYMHLRGYKYARLDGSVGLTERKERMEEFNNAEVDTMIFMLSTRAGGLGLNLQAADTVVLFDSDFNPHQDLQAMCRAHR
LGQTKQVKVFRLVTISGVEEIILEKANRKLNIDQMVIQAGMFDNKSSEELREEKLRLLLLLHKGTTGDTTATTPLQLNRI
LARTEEEQNWFDEYDCRLFGKPLEELRLQDDQDLERAAAAAEAAGAALAAAVEATGAQEEEEEKEKTMNRLSSQLDDEKP
VEEDSENEGDSPEETFEETEKGGDEGGARPTRLRRGDDPTDTEEQDGSREGPTSAKREAEVEVAETTAVRVRDAEAKKGV
GIGSGEPAKYESEPKKAAVAEFLEAAGRLMCVSELPAWIVEDEEEPANAKSEEDDDEGPAGRRKRRQRGCVGRVRYCDSL
SDAKYVKLIEKYENGELWEEGLEEALLREIERQEQRRRRREMRKGGDTSACMSPTADLEAGRAQRSASGRSARETPRQNA
PRNASNSPPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPVGSGGRGRRRTRSGTEDEKGRDKGDCMRYASRSR
TRTRRSRGDSELSDGIRGRSSKEDDDAADNNSMEEEAE

Gene-Specific Links for TGME49_120300

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins