ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_120110 (PCNA2)

proliferating cell nuclear antigen, putative, a gene from Toxoplasma gondii

Compiled localisation
replication foci during tachyzoite s-phase
cytoplasm and nucleus during early tachyzoite g1 phase and tachyzoite mitosis

Who localised this protein by microscopy?

Guerini, M. N., Behnke, M. S., White, M. W.
Biochemical and genetic analysis of the distinct proliferating cell nuclear antigens of Toxoplasma gondii. (2005 Jul, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

replication foci during tachyzoite s-phase, cytoplasm and nucleus during early tachyzoite g1 phase and tachyzoite mitosis
  • "In all cell cycle phases, TgPCNA1 is concentrated in the nucleus, while TgPCNA2 is only concentrated in the nucleus during S-phase and uniformly distributed throughout the cell during mitosis and early G1-phase. TgPCNA1-GFP and native TgPCNA2 display a punctate staining pattern that is consistent with assembly into replication foci during S-phase; however, TgPCNA2 disassociates from replication foci before TgPCNA1-GFP."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: blast from AF242302.1, annotation matches
  • Localisation record: replication foci during tachyzoite S-phase, cytoplasm and nucleus during tachyzoite mitosis and early tachyzoite G1 phase
  • Other genes localised in this publication: proliferating cell nuclear antigen 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_22031

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFL1285c proliferating cell nuclear antigen 2
  • PBANKA_144140 proliferating cell nuclear antigen 2, putative
  • PY06718 proliferating cell nuclear antigen
  • PVX_123960 proliferating cell nuclear antigen, putative
  • PCHAS_144340 proliferating cell nuclear antigen 2, putative
  • PKH_144340 proliferating cell nuclear antigen, putative
  • NCLIV_010140 proliferating cell nuclear antigen, putative
  • cgd3_3470 proliferating cell nuclear antigen
  • Chro.30392 proliferating cell nuclear antigen
  • CMU_010600 proliferating cell nuclear antigen PCNA, putative
  • TP02_0600 proliferating cell nuclear antigen, putative
  • TA14075 proliferating cell nuclear antigen 2 (PCNA2), putative
  • BBOV_II006360 Proliferating cell nuclear antigen
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_120110 proliferating cell nuclear antigen, putative
MFECTIEGLLLKRLMECLKEMVTDVNLVCNASGISLDSMDGSHVAVVDVRLAVDLFHKYRCDRPVQLGLSVPNLLLALQP
VKSAETLVHLSSLHGDDEDDEEDTILHINIEDPESGDTWSMEVRLLDVESEQLEVPEHTEHEATAVVRSKELQDLVRYLN
SLSESIVVKMDKTHMQLSARGDSVAASRKMQPESLVCTNSTEHEFAARYLNMFLKGAVLADFVEIGCSHGLPMQISFRLK
LQAERERDAKKKGADRLHDVKMDEDEGPQSRSTLSFYLAPRIEDDEE

Gene-Specific Links for TGME49_120110

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins