ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_119920 ()

dihydrolipoamide branched chain transacylase, E2 subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11356

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFC0170c dihydrolipoamide acyltransferase, putative
  • PBANKA_040230 dihydrolipoamide acyltransferase, putative
  • PY00503 Plasmodium vivax PV1H14105_P
  • PVX_119310 dihydrolipoamide acyltransferase, putative
  • PCHAS_040320 dihydrolipoamide acyltransferase, putative
  • PKH_083650 dihydrolipoamide acyltransferase, putative
  • TGME49_119920 dihydrolipoamide branched chain transacylase, E2 subunit, putative
  • NCLIV_010320 dihydrolipoamide branched chain transacylase, E2 subunit, putative
  • TA08530 2-oxoglutarate dehydrogenase complex subunit, putative
  • BBOV_II001300 lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_119920 dihydrolipoamide branched chain transacylase, E2 subunit, putative
MLATRRVFSASPRLVCARAGIAQAFVPRPLAPLTRLGAGCLPQRQLELNNAPLVLPGKRCLLTVSRPALAVKTFKLADIG
EGIAQVELLKWHKGVGDHVEEMDELCEVQSDKAAVEITSRFTGTIVKLHQKEGMMVRIGAPLMDIDVEAGEDHAEEEEPE
TKERPAPVSEPQAAASPSVGAEASSTTFSASPATRRFAKEKGVDLARVKGSGRNGLITKEDVLKFLESSQVAAPAAQSPP
PAPAQGSFAGSPNAQPRAAPVVPQRPQRETTQVQLMGFSRAMVKSMNETVKVPQLNIGDEYDITELTKMRETLVAHTAKK
YNCRPTITAFLIKAVSLALDETPILNSKFNAATGDSYTQFGSHNISVAIDTPNGLVVPNIKNVQDLNVLEIQAELHRLQE
LATANKLSPADLQGGTISISNVGVISGTYVHALLFDGQACIIGVGQARDLPRFVGKSGQAFDEDLVERRRIMTCAFTADH
RHCDGATVARFNKRVKELLENPAMMLLHLR

Gene-Specific Links for TGME49_119920

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins