ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_119870 ()

ubiquitin-conjugating enzyme domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10359

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL0190w ubiquitin conjugating enzyme E2, putative
  • PBANKA_060280 ubiquitin-conjugating enzyme e2, putative
  • PY03025 putative ubiquitin-conjugating enzyme
  • PVX_084235 ubiquitin-conjugating enzyme E2 4, putative
  • PCHAS_060460 ubiquitin-conjugating enzyme e2, putative
  • PKH_130250 ubiquitin conjugating enzyme E2, putative
  • TGME49_119870 ubiquitin-conjugating enzyme domain-containing protein
  • NCLIV_010370 Ubiquitin carrier protein (EC 6.3.2.-), related
  • cgd4_570 ubiquitin-conjugating enzyme
  • Chro.40073 ubiquitin-conjugating enzyme
  • CMU_012700 ubiquitin-conjugating enzyme family protein
  • TA04605 ubiquitin-conjugating enzyme E2, putative
  • BBOV_IV002040 ubiquitin-conjugating enzyme E2
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_119870 ubiquitin-conjugating enzyme domain-containing protein
MCKEGLVAQEGGHCIQLCPSDAKRKTDLDFSTIFRLSRPLTLFTSAKPSKAIRGRHGEREVGRTNPPPPSAFFTDISTAF
HAFRLAFFSTFLPSPSSQLAGLPASPNLPGRPRIRSRPRRRRRVPNCFYRSKEPPSRQVVVSLVQSPLKQKGLPFASLPP
LTGILVSRLSVFLWTAAKVHPASSPRLRSIHTDTEVSTMALKRINKELNDLSKDPPTNCSAGPVGDDMFHWQATIMGPED
SPYSGGVFFLNIHFPSDYPFKPPKVNFTTKIYHPNINSQGAICLDILKDQWSPALTISKVLLSISSLLTDPNPDDPLVPE
IAHLYKSDRMRYDQTAREWSQKYAQ

Gene-Specific Links for TGME49_119870

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins