ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_119560 (MIC3, MIC 3)

microneme protein MIC3, a gene from Toxoplasma gondii

Compiled localisation
microneme during bradyzoite and intracellular tachyzoite and tachyzoite
not rhoptry during tachyzoite
parasite plasma membrane during tachyzoite invasion

Who localised this protein by microscopy?

Huynh, M. H., Carruthers, V. B.
Tagging of endogenous genes in a Toxoplasma gondii strain lacking Ku80. (2009 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

microneme

Nishi, M., Hu, K., Murray, J. M., Roos, D. S.
Organellar dynamics during the cell cycle of Toxoplasma gondii. (2008 May 1, J Cell Sci) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite

El Hajj, H., Papoin, J., Cerede, O., Garcia-Reguet, N., Soete, M., Dubremetz, J. F., Lebrun, M.
Molecular signals in the trafficking of Toxoplasma gondii protein MIC3 to the micronemes. (2008 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "The IFA of intracellular tachyzoites with polyclonal anti-MIC3 (red) shows apical punctate fluorescence that is typical of microneme staining (vacuoles on the left side) or ER-Golgi complex staining (arrowhead; vacuoles on the right side)"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: -

Matthiesen, S. H., Shenoy, S. M., Kim, K., Singer, R. H., Satir, B. H.
Role of the parafusin orthologue, PRP1, in microneme exocytosis and cell invasion in Toxoplasma gondii. (2003 Sep, Cell Microbiol) PubMed / full text
   more detail about this publication

microneme during tachyzoite
  • "The fluorescence micrographs show that staining of the apical end is reduced after invasion (2┬ámin) for both PRP1 and the microneme content protein MIC3."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: micronemes during tachyzoite
  • Other genes localised in this publication: phosphoglucomutase/parafusin related protein 1, putative

Meissner, M., Reiss, M., Viebig, N., Carruthers, V. B., Toursel, C., Tomavo, S., Ajioka, J. W., Soldati, D.
A family of transmembrane microneme proteins of Toxoplasma gondii contain EGF-like domains and function as escorters. (2002 Feb 1, J Cell Sci) PubMed / full text
   more detail about this publication

microneme during tachyzoite
  • "Double labeling with mouse -MIC3 and rabbit -MIC8 confirmed the microneme localization of TgMIC8."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during tachyzoite
  • Other genes localised in this publication: microneme protein MIC6, microneme protein 7, microneme protein 8

Striepen, B., Soldati, D., Garcia-Reguet, N., Dubremetz, J. F., Roos, D. S.
Targeting of soluble proteins to the rhoptries and micronemes in Toxoplasma gondii. (2001 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during tachyzoite
  • "In order to study the targeting of proteins to these specialized secretory organelles, we have engineered green fluorescent protein (GFP) fusions to the rhoptry protein ROP1 and the microneme protein MIC3"
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during tachyzoite
  • Other genes localised in this publication: rhoptry protein, putative

Ding, M., Clayton, C., Soldati, D.
Toxoplasma gondii catalase: are there peroxisomes in toxoplasma? (2000 Jul, J Cell Sci) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "Staining for the dense granules was obtained by using anti-GRA3 antibodies (Leriche and Dubremetz, 1991), an anti-MIC3 was used to detect the micronemes (Achbarou et al., 1991) and an anti-ROP2 for the rhoptries (Fig. 6)."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RHhxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: peroxisomal catalase, dense granule protein 3, Rhoptry kinase family protein ROP2A (incomplete catalytic triad)

Garcia-Reguet, N., Lebrun, M., Fourmaux, M. N., Mercereau-Puijalon, O., Mann, T., Beckers, C. J., Samyn, B., Van Beeumen, J., Bout, D., Dubremetz, J. F.
The microneme protein MIC3 of Toxoplasma gondii is a secretory adhesin that binds to both the surface of the host cells and the surface of the parasite. (2000 Aug, Cell Microbiol) PubMed / full text
   more detail about this publication

microneme and not rhoptry during tachyzoite, parasite plasma membrane during tachyzoite invasion
  • "Immunofluorescence analysis of T. gondii tachyzoite invasion showed that MIC3 was exocytosed and relocalized to the surface of the parasite during invasion."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from CAB56644, annotation matches
  • Localisation record: microneme and not rhoptry during tachyzoite, surface during tachyzoite invasion
  • Other genes localised in this publication: -

Achbarou, A., Mercereau-Puijalon, O., Autheman, J. M., Fortier, B., Camus, D., Dubremetz, J. F.
Characterization of microneme proteins of Toxoplasma gondii. (1991 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during bradyzoite and tachyzoite
  • "In all cases, apical labeling of tachyzoites and bradyzoites was observed by indirect immunofluorescence assay. Immunogold localization on ultrathin sections of bradyzoites or tachyzoites showed a specific labeling of micronemes. The following proteins were characterized using 2-dimensional gel electrophoresis and Western immunoblotting: Mic 1 (60 kDa, Pi 6.5), Mic 2 (120 kDa, Pi 5) and Mic 3 (90 kDa, Pi 6.75)"
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during tachyzoite and bradyzoite
  • Comment: fulltext not available online
  • Comment: strain information not found
  • Other genes localised in this publication: microneme protein MIC1, microneme protein 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114385

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_119560 microneme protein MIC3
MRGGTSALLHALTFSGAVWMCTPAEALPIQKSVQLGSFDKVVPSREVVSESLAPSFAVTETHSSVQSPSKQETQLCAISS
EGKPCRNRQLHTDNGYFIGASCPKSACCSKTMCGPGGCGEFCSSNWIFCSSSLIYHPDKSYGGDCSCEKQGHRCDKNAEC
VENLDAGGGVHCKCKDGFVGTGLTCSEDPCSKRGNAKCGPNGTCIVVDSVSYTCTCGDGETLVNLPEGGQGCKRTGCHAF
RENCSPGRCIDDASHENGYTCECPTGYSREVTSKAEESCVEGVEVTLAEKCEKEFGISASSCKCDNGYSGSASATSHHGK
GESGSEGSLSEKMNIVFKCPSGYHPRYHAHTVTCEKIKQ

Gene-Specific Links for TGME49_119560

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins