ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_119530 ()

splicing factor, putative, a gene from Toxoplasma gondii

Compiled localisation
not apicoplast and not nucleolus and nucleus during tachyzoite

Who localised this protein by microscopy?

Gubbels, M. J., Wieffer, M., Striepen, B.
Fluorescent protein tagging in Toxoplasma gondii: identification of a novel inner membrane complex component conserved among Apicomplexa. (2004 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nucleus and not apicoplast and not nucleolus during tachyzoite
  • "Double labeling immunofluorescence experiments using antibodies directed against ACP and fibrillarin demonstrated that this body was neither the apicoplast (Fig. 4A-D), nor the nucleolus, respectively (Fig. 4E-H), but was localized within the nucleus in close association with the nucleolus [26]."
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain: RH
  • Gene model mapping comments: Blast from AY615399
  • Localisation record: nucleus and not apicoplast and not nucleolus during tachyzoite
  • Other genes localised in this publication: hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12350

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_119530 splicing factor, putative
MSRHSPSPRRRRSPSPRQGSRIFVANLPLDVTENELEDLFYKFGRIEDIEMRRDRTNDSTIAFVQFAEYKAADDAIEGRD
GAHLGFHRIRIERSRQRLRRPGEFRRDRGGYGGRESGGNGPAYGPPRRSEFRVRVYGLPPTASWQDLKDHMRRAGDVGYA
NIEGGVGVVEYSNGDDMDYALRKLHGSVFRNIFHTAKIRVERDLGDDYVPSRRRPSLGRERDRQVPGEKAFFARGSAFHQ
REELIRTPVQGEGRSSEQTDGLSRRRNESKLWGASDTVDRRACWKRSRHRSRSPRGGRRGSRSPVEYSSPERRREEAERE
RRRCARDEEEARHTRRSRSASSRHGRRREEAYSDHEERREKSLDGDRFEETERGKPREREDGRRPRSVSRSSQESRGERD
GLAKDEREKGETRRDDERERRSRSPSDYRGRGQKRDREDEREDDRRRVRGDDFSEETRRNGLERDERGERDERDERDDRE
GVRRSFERDREETRRGRRDEEREEARHSGDEE

Gene-Specific Links for TGME49_119530

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins