ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_118730 ()

UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T3, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12174

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • TGME49_118730 UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T3, putative
  • NCLIV_010830 UDP-N-acetyl-D-galactosamine:polypeptide N- acetylgalactosaminyltransferase T3, putative
  • NCLIV_027240 UDP-N-acetyl-D-galactosamine:polypeptide N- acetylgalactosaminyltransferase T1, putative
  • NCLIV_067480 UDP-N-acetyl-D-galactosamine:polypeptide N- acetylgalactosaminyltransferase T5, putative
  • cgd5_690 extracellular protein with a ricin domain and a family 2 glycosyltransferase domain
  • Chro.50322 UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T3
  • Chro.70461 UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T1
  • CMU_014290 glycosyl transferase, group 2 family protein
  • CMU_041230 glycosyl transferase, group 2 family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_118730 UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T3, putative
MRVMTPPSAPHPRASPWWASCLWAALQIILFLVGICWVAVNVGFLSDYYFKGSDFSSPSLNNNSDASRQPPRAARDVQEG
VSSFEESGGAQLPPRVHALEVLEGAGPGRLHGRLGIKPDGQPGYTRAPSPPTDLSMPQALARGGGFNLYLSDHLELDRTA
PDARHASCRQLHYDLSTLPKASVIIVFYNEPFSTLMRSVHSVLNGTPPQILEELILVDDGSTLPYIREDGNQQLVEYLKL
LPAKVRLIRNEVRKGIVGARMKGIRASRAPIFAILDSHIEVSPQWLEPLLLRIKEDGRRVVMPQIDGIDAETFKHIAGGI
GCKLGFLWKLMEHSYEGHQTARLPPEERQPSPTDFQTSPAMAGGLFAANKAFFFDVGAYDEDFQFWGTENLELSFRLWQC
GGVLECAPCSRVYHIFRKGGSGYSSPGDSITINKMRTMLWMDEYADLAWRVIGKPRVNYRPESLEKRREWRKRKGCKSFR
WFMENVFPEGDVVTLDDVPYLGPLRNDKIGMCLDNMGWASPGHAVGLEYCHGGDTQTFMFFRKVGHVMPVNDDEACLQPS
GRLDWCRGTAQFWWDFTSSGQLMFRETKQCLSAFGRKLRMVECDDTDPYQIWSWTAYNPPDTFTFPSVSRSIRSG

Gene-Specific Links for TGME49_118730

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins