ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_118720 ()

proline synthetase co-transcribed protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10596

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI0965w pyridoxal 5'-phosphate dependent enzyme class III, putative
  • PBANKA_082060 pyridoxal 5'-phosphate dependent enzyme class III, putative
  • PVX_099400 hypothetical protein, conserved
  • PCHAS_082090 pyridoxal 5'-phosphate dependent enzyme class III, putative
  • PKH_071690 conserved Plasmodium protein, unknown function
  • TGME49_118720 proline synthetase co-transcribed protein, putative
  • NCLIV_010840 hypothetical protein
  • cgd5_620 conserved hypothetical protein
  • Chro.50329 hypothetical protein
  • CMU_041300 hypothetical protein, conserved
  • TP02_0565 hypothetical protein, conserved
  • TA13895 proline synthetase associated protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_118720 proline synthetase co-transcribed protein, putative
MAFDASSLDLLIRENLKRVREEILTLSVRRSVAPSAVNDKGNDAKTDSACSSLPSWSSCEGALRETEGCVRLLAVSKYQP
ASAVAAAALAGQRHFGENYVQELVEKATQLCHLDLKWHMIGHLQSNKAKQLLMGCPQLYAVETVDSKKLAKTLNDAVATV
LSQRNGAPLRVLVQVNASDEASKSGVRLHSVDGNRGETETPCGDSEVRELVEYIVDSCPHLRFSGLMTIGHPDPERTSGT
FAKMATLRLDLLKLPHVRQVFMSRTESAGEREAYDRSERKSSNTSEAARNTRNKAEEARPLHAAFDRDDLFELSMGMSGD
MAEAIIHGSTEVRIGTAIFGSRPLQPKSRS

Gene-Specific Links for TGME49_118720

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins