ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_118700 ()

eukaryotic translation initiation factor 6, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10934

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0178 translation initiation factor 6, putative
  • PBANKA_134760 translation initiation factor 6, putative
  • PY01848 eukaryotic translation initiation factor 6-like protein
  • PVX_082570 eukaryotic translation initiation factor 6, putative
  • PCHAS_135220 translation initiation factor 6, putative
  • PKH_122010 eukaryotictranslation initiation factor, putative
  • TGME49_118700 eukaryotic translation initiation factor 6, putative
  • NCLIV_010860 eukaryotic translation initiation factor 6, putative
  • cgd4_3130 putative eIF6, translation initiation factor 6
  • Chro.40357 eukaryotic translation initiation factor 6-like protein
  • CMU_018240 eukaryotic translation initiation factor 6, putative
  • TP02_0333 translation initiation factor 6, putative
  • TA12585 eukaryotic translation initiation factor 6, putative
  • BBOV_III005890 translation initiation factor eIF-6 family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_118700 eukaryotic translation initiation factor 6, putative
MNASCAALWSLGSSRMATRAQFESSNEVGVFAKLTNSYCLVALGGSEHFYSTLEAELAPHIPVVHATVGGTRVIGRVCVG
NRRGLIVPSITTDQELQHLRNSLPDSVEIRRVEERLSALGNNVACNDYVALLHTDMDKETEEIVQDVLGVEAFRATIGKQ
TLVGSYCHFTNQGGLVHVMTPVEDMEELSQLLQVPLTAGTVNRGSDLVGAGLIANDWAAFCGMDTTATELAVVERIFKIA
TRNQQKLNLVDDLTLRSSLIDTLS

Gene-Specific Links for TGME49_118700

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins