ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_118510 ()

N-ethylmaleimide-sensitive factor, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11240

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_040160 N-ethylmaleimide-sensitive fusion protein, putative
  • PY05628 ATPase, AAA family, putative
  • PVX_119275 N-ethylmaleimide sensitive fusion protein, putative
  • PCHAS_040250 N-ethylmaleimide-sensitive fusion protein, putative
  • PKH_083720 N-ethylmaleimide sensitive fusion protein, putative
  • TGME49_118510 N-ethylmaleimide-sensitive factor
  • NCLIV_011040 N-ethylmaleimide-sensitive factor, putative
  • cgd2_3010 N-ethylmaleimide-sensitive factor (NSF1)-like AAA ATpase involved in vesicular transport
  • Chro.20314 N-ethylmaleimide-sensitive factor; NSF; Sec18p
  • CMU_030460 vesicle-fusing ATPase, putative
  • TP02_0172 N-ethylmaleimide sensitive protein, putative
  • TA11700 N-ethylmaleimide-sensitive factor, putative
  • BBOV_II007200 N-ethylmaleimide-sensitive factor, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_118510 N-ethylmaleimide-sensitive factor
MAFVLTTVKLPSKDVAFTNCAYVNPRVYATLRQTAASSGDVSGNAILCEVKNIVVSVMPDGLLQENEIGLNTCQRESARI
QLRDEVALRPFQLPADREHLYQIGVMQVEVSTYLKPESRIVVHDDKLEEEFRSLFCRQIFTQHQSVAMKLDERQALKMTV
KEMLPFEGTSRQSSRLLTRGQLTEKTQVLFVGADDGRVCVQSRRMLQRNILTPDFNFEELGIGGLDKEFNEIFRRAFASR
IFPPAIVQEMGIKHVRGMLLYGPPGTGKTLIARQIGKSLRAREPVIVNGPEILNKYVGQSEENIRNLFKAAEDEYRKLGD
NASLHIIIFDEIDAICKQRGSNPSSAGVNDSIVNQLLSKIDGVEALNNILLIGMTNRLDMIDEALLRPGRLEVHIEIGLP
DESGRIQILSIHTKQMRESGRLGNDVDLAVLAAETKNFSGAEIEGLVRSAASYAFQRNVNVKDLSKPTDVETIKVTRLDF
ENALTEVKPAFGAEEDLFDSCLRNGIISYGPEFDHLLQTCTTLAQQVRDSENTQVLSILLHGPPGSGKTALAAHVAKEAQ
FPFMKLVTPDNFVGFSEAARTNSLSRTFDDAYKSPLSLLMIDNIERLIDFTPIGPRFSNAVLQALVVLVKKMPAKENRRL
LILATTSEFDFMKEAGVAKAFNVSLQVPLVRGPHQIRTVLQAHCGSRHVFPPEEISLVCESGKVHDVSIKQLLLVTDMAK
EFSKPGPIKCGPFLQCLHDCGYEGSYDPMPF

Gene-Specific Links for TGME49_118510

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins