ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_118160 ()

major sperm protein domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10804

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0377 vesicle-associated membrane protein, putative
  • PBANKA_130370 vesicle-associated membrane protein, putative
  • PY06882 hypothetical protein
  • PVX_118500 vesicle-associated membrane protein, putative
  • PCHAS_130690 vesicle-associated membrane protein, putative
  • PKH_126650 vesicle-associated membrane protein, putative
  • TGME49_118160 major sperm protein domain-containing protein
  • NCLIV_011320 Vesicle-associated membrane protein-associated protein A, related
  • cgd6_2620 vesicle-associated membrane protein,MSP (major sperm protein) domain, transmembrane domain or GPI at C
  • Chro.60303 conserverd MSP-domain transmembrane protein
  • CMU_007210 MSP domain-containing protein
  • TA08575 vesicle-associated membrane protein, putative
  • BBOV_II001250 vesicle-associated membrane protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_118160 major sperm protein domain-containing protein
MAGPLLRITPEKVIEFPVVLFSSSTVELHLENTADTFVAFKIKTTAPKSYLVRPSTGIIPRGGKEVVHIVLQPLSEEPTR
PCSDRFLIQSTAVSSDAPLARDYWQTLDRERIEDTRLSVVYRTSGSSGDHVGGAGMSAAEGSGSSSRGGYGGASGSQGGS
YSADLKSRYDQLVEYALALERHKDELVKENEALKAQLGRKGATQKSGGMGVFELWHIPVYIFIGVVIWYFFGRSAEITK

Gene-Specific Links for TGME49_118160

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins