ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_117720 ()

eukaryotic translation initiation factor 3 subunit 7, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11707

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF10_0077 eukaryotic translation initiation factor 3 subunit 7, putative
  • PBANKA_120610 eukaryotic translation initiation factor 3 subunit 7, putative
  • PY04269 eukaryotic translation initiation factor 3 subunit 7
  • PVX_094590 eukaryotic translation initiation factor 3 subunit 7, putative
  • PCHAS_120680 eukaryotic translation initiation factor 3 subunit 7, putative
  • PKH_080670 eukaryotic translation initiation factor 3 subunit 7, putative
  • TGME49_117720 eukaryotic translation initiation factor 3 subunit 7, putative
  • NCLIV_012130 Eukaryotic translation initiation factor 3 subunit 7-like protein, related
  • cgd2_270 translation initiation factor eIF-3 subunit 7
  • Chro.20034 eukaryotic translation initiation factor 3 subunit 7
  • CMU_010200 eukaryotic translation initiation factor 3 subunit 7 family protein
  • TA18225 eukaryotic translation initiation factor 3 subunit 7, putative
  • BBOV_III000500 eukaryotic translation initiation factor 3 subunit 7, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_117720 eukaryotic translation initiation factor 3 subunit 7, putative
MEQASEERPHFEHIANPGSLFGCHPQSAGWGPSTCDKEVRTECLAALAHLPFEPNRQRDGRDPRGITVAFADEEQQFQTV
DNRPLLRRGGGGGWLHKRRAPVKQSTAAFNEKNKEEEELRLGKKGKSEQKKQQQQQQASKIKVKDLAWRGELRTYNKQAD
QIRTKLPVALQNLSSNFDYYWVTTQDDDLIKEQMLNSSEPIDVAATDQVLACLMAAPQSKYSWHLHLTKVEGKLLIDKAN
GSIVDLLTVNETASEPPMQDAENRLNRPAALGFEAVKINQNLRQQLLVKGEEPVKFSPPPFVEAGDNPASIAYRYRMFTI
PGRTGGTGGGKSRQPINIITRTEVNAKLPQPADGSRKPSPGDEMTGGHSKREKEDSDPFGKDGGGYVYICALNEYDIKGQ
RNWRVQMETQRGALLATEVRNNACKLKKFVASAMMAGCDDLKLGFVSRKANNDNEHHVVLSVQSYQTRDLGMQIGLKPDN
AWGIVRAIVDMVMEKPDGRYVLLKDPTKPVMRLYSRPEEEDEDAEEEEKAPETRTEERETNRNDEE

Gene-Specific Links for TGME49_117720

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins