ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_116540 (ISP3)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
basal region of inner membrane complex and central region of inner membrane complex

Who localised this protein by microscopy?

Beck, J. R., Rodriguez-Fernandez, I. A., Cruz de Leon, J., Huynh, M. H., Carruthers, V. B., Morrissette, N. S., Bradley, P. J.
A novel family of Toxoplasma IMC proteins displays a hierarchical organization and functions in coordinating parasite division. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

basal region of inner membrane complex and central region of inner membrane complex
  • "ISP1 localizes to the apical cap portion of the IMC, while ISP2 localizes to a central IMC region and ISP3 localizes to a central plus basal region of the complex."
  • Microscopy type: fixed light
  • Microscopy method: C terminal HA tag
  • Strain: RH hpt-
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: central region of IMC and basal region of IMC
  • Other genes localised in this publication: hypothetical protein, hypothetical protein, caltractin, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_34375

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_116540 hypothetical protein
MGNTACCGFDSDSTADLEIGREGEVRSRKPIQVSKEAFDNWMNRYEAGDTMEVLFPDGHRIECNLKIDRPKNFMNLTFNQ
KVRPIQLDDIAAVLYGSDPRSSECADSKMLRNPCVVGFRLASSGRAIAFSFKDITDAQCFVSFLDDEIKKNQESNKSSAS
NDRN

Gene-Specific Links for TGME49_116540

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins