ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_116400 (alpha tubulin, TUBA1)

tubulin alpha chain, a gene from Toxoplasma gondii

Compiled localisation
inner membrane complex during tachyzoite schizont
nascent conoid

Who localised this protein by microscopy?

Hu, K.
Organizational changes of the daughter basal complex during the parasite replication of Toxoplasma gondii. (2008 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

nascent conoid
  • "The EGFP-TgMORN1 rings (green arrows close to the dotted frames in the TgMORN1 and the merged panels) are formed around the centrioles and possibly nascent conoids highlighted by mCherryFP-TgTubA1 (red arrows at the bottom of the TgTubA1 and the merged panels)."
  • Microscopy type: Light
  • Microscopy method: mCherry tag
  • Strain: RH
  • Gene model mapping comments: annotation matches
  • Localisation record: nascent conoid
  • Other genes localised in this publication: phosphatidylinositol-4-phosphate 5-kinase, putative, caltractin, putative, membrane skeletal protein IMC1, putative

Striepen, B., Crawford, M. J., Shaw, M. K., Tilney, L. G., Seeber, F., Roos, D. S.
The plastid of Toxoplasma gondii is divided by association with the centrosomes. (2000 Dec 25, J Cell Biol) PubMed / full text
   more detail about this publication

inner membrane complex during tachyzoite schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10075

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_116400 tubulin alpha chain
MREVISIHVGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGKHVPRCVFLDLEPTVVDEVRT
GTYRHLFHPEQLISGKEDAANNFARGHYTIGKEIVDLSLDRIRKLADNCTGLQGFLMFNAVGGGTGSGLGCLLLERLSVD
YGKKSKLNFCSWPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRNLDIERPTYTNLNRLIAQVISSLTA
SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYR
GDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAIAEVFSRMDHKFDLMYA
KRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIETAEGEGEEEGYGDEY

Gene-Specific Links for TGME49_116400

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins