ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_116330 (SOD2, SODB2)

iron-containing superoxide dismutase, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during tachyzoite
mitochondrion during intracellular tachyzoite and tachyzoite

Who localised this protein by microscopy?

Pino, P., Foth, B. J., Kwok, L. Y., Sheiner, L., Schepers, R., Soldati, T., Soldati-Favre, D.
Dual targeting of antioxidant and metabolic enzymes to the mitochondrion and the apicoplast of Toxoplasma gondii. (2007 Aug 31, PLoS Pathog) PubMed / full text
   more detail about this publication

apicoplast and mitochondrion during tachyzoite

Ding, M., Kwok, L. Y., Schluter, D., Clayton, C., Soldati, D.
The antioxidant systems in Toxoplasma gondii and the role of cytosolic catalase in defence against oxidative injury. (2004 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

mitochondrion during intracellular tachyzoite

Brydges, S. D., Carruthers, V. B.
Mutation of an unusual mitochondrial targeting sequence of SODB2 produces multiple targeting fates in Toxoplasma gondii. (2003 Nov 15, J Cell Sci) PubMed / full text
   more detail about this publication

mitochondrion during intracellular tachyzoite
  • "Intracellular parasites showed colocalization of the GFP signal with MitotrackerTM staining, indicating that TgSODB2 associates with the mitochondrion. TgSODB2 did not colocalize with MitotrackerTM in the host cell mitochondria surrounding the PV, demonstrating the specificity of targeting (Fig. 4A)."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 2F
  • Gene model mapping comments: blast from AY176062
  • Localisation record: mitochondrion during intracellular tachyzoite
  • Other genes localised in this publication: acyl carrier protein, hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10139

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_116330 iron-containing superoxide dismutase
MSITAVLVPALRLSAALVAAPIGLALETAALTTSHGPRQVTSRFLHLCPPSASLSSCNKTVQGRIAHVRSPYLQRDAHCF
STNACAFTLPPLPYAEDALAPHISAETLRFHHGKHHAAYVNKLNGFIQGTPFADKTLEDIVKNSSGAIFNNAAQAWNHEF
YFKSMKPASAGGGGEPDGLLKKEIEAAFSSFAQFKDEFSKLAAGHFGSGWAWIVWDKQQKKIVLEQTHDANTPITDTMKV
PLLCCDVWEHAYYLDKKNDRPAYIEGWWSVVNWGFAAENLVKALESN

Gene-Specific Links for TGME49_116330

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins