ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_116190 (SOD3, SODB3) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

superoxide dismutase, putative, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during intracellular tachyzoite

Who localised this protein by microscopy?

Pino, P., Foth, B. J., Kwok, L. Y., Sheiner, L., Schepers, R., Soldati, T., Soldati-Favre, D.
Dual targeting of antioxidant and metabolic enzymes to the mitochondrion and the apicoplast of Toxoplasma gondii. (2007 Aug 31, PLoS Pathog) PubMed / full text
   more detail about this publication

mitochondrion during intracellular tachyzoite

Ding, M., Kwok, L. Y., Schluter, D., Clayton, C., Soldati, D.
The antioxidant systems in Toxoplasma gondii and the role of cytosolic catalase in defence against oxidative injury. (2004 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

mitochondrion during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10139

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_116190 superoxide dismutase, putative
MFAAVARRTATGTLPGAVTLFGRKSFEGYYRDYPLHPRNFGVMASLFSTGKFELPALPYDYNALEPYISAKTLKFHHDKH
HATYVKNLNELIKGTDYENQKLEDIIRNADGPTFNNAAQAWNHTFFWNSMKPNGGGEPTGLVKEQIDRCFSSFSKYKEEF
SEKATKHFGSGWAWLVWCNEKRRLEVIETHDAGNPITMKKWPIITCDLWEHGYYLDRQNDRGAYVKSWWSVVNWDFANEK
LEKAMRGDPIDETVGGGQ

Gene-Specific Links for TGME49_116190

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins