ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_115560 (ABCG77) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

ABC transporter, putative, a gene from Toxoplasma gondii

Compiled localisation
golgi apparatus and parasite plasma membrane during intracellular tachyzoite

Who localised this protein by microscopy?

Ehrenman, K., Sehgal, A., Lige, B., Stedman, T. T., Joiner, K. A., Coppens, I.
Novel roles for ATP-binding cassette G transporters in lipid redistribution in Toxoplasma. (2010 Jun 1, Mol Microbiol) PubMed / full text
   more detail about this publication

golgi apparatus and parasite plasma membrane during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_15570

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_115560 ABC transporter, putative
MPSHPNLESTTPPVHDHSGGQPTESLTSICQKKIADYAVPVENYWSTDRLSPVALDRETTTVSEPRPIPSCYALSTIGSR
SPAAEVRNSSASRCGGASPPSPENGAARSGVVQVLTPPRVVTLHKEADDSVQMKETEQAKRAARLQVAPPPSAYARPRQI
LFGLSGYFAPGEIVGILGPSGAGKSTFLSVLCGRLKKGVGGLIDINGEPAPARMKKIVGYVMQQEYFFGNLTVEETLMYT
ARLRLGKKTSFAEKKARVEEVINSMKLNKCRGTRVGSAFCRGLSGGELKRLNIANELLLHPSLFLLDEPTSGLDASISAA
LLDMLKQLTRANRCTTVCTIHQPNSNVFMRFDRVIFLKDGHIVYQGKPSDVCAYFSSLNFHCPEGWNIADYALHVISASD
DENFRRRSLTSTTAAGGDPITGSTHGEQVRLERETAQRSSVLARYRINSFEEPKEVGNLSADASSLGRGPFACRAARTSS
GSDRTRETNLFGEIIGRQTREAGSVEAASELRNGQQPGETEKDDDKLTGAYGAQPDFSAAHGLEAVSVVKHFCDGPLRPP
EESTASALSAATSHAEDADNHFLIKTYQRRINITTFQLRLHDLSIDLVKDPSEQKTHGCKAEHGDSQKCDCDPIKDYSGC
GGITQHDAADAFLASSMIKSHSLERTHSGEDEPGPKSGHDQRKPNTLLEEGAAAETSMNSFEVFTATAVEATHEHILEPL
NNKTTRQNVRSLDLAEQTKSVSGENLTLERMERRNILSSIPSCGCVLNRGTPQRNAEFSAGAPSLSNAQAWSDKLASFPA
KKMEWSGRKFSKRTSFLSFDEEIKVAMSEPSYFQQVWVLVCRGIRKELKGKSTTLDLVQAAVIGAVVGSLYFQSCRDYSE
EKLLDRMGLLYFTTSYYSFGPAYMAFTSFPAERAVISRERSSKAYKVSCYLLAKTMIDLVVQIFTPSLWLAIVYPLVGLP
SDLGVFMAFWAQLVLLVCIAQAIGQLIAAIVVDDARLGGLLLSVILISSSISSGFYVQQQRLGPWISWLRWLSFQNYAVT
NFVIVTVGSSSTLSCSEFSSFPTCPGQPITAEMITRRFTTALSPLSNITLMICTWLAIKLMCYGVLKKSLKLKS

Gene-Specific Links for TGME49_115560

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins