ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_115220 (ROP14)

rhoptry protein, putative, a gene from Toxoplasma gondii

Compiled localisation
rhoptry during tachyzoite

Who localised this protein by microscopy?

Bradley, P. J., Ward, C., Cheng, S. J., Alexander, D. L., Coller, S., Coombs, G. H., Dunn, J. D., Ferguson, D. J., Sanderson, S. J., Wastling, J. M., Boothroyd, J. C.
Proteomic analysis of rhoptry organelles reveals many novel constituents for host-parasite interactions in Toxoplasma gondii. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_16717

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_115220 rhoptry protein, putative
MYSSPQSEEASLVNSRGIRDESGPNGFSIGSATDTALKAGSPTGKSWKQLSLNLGRRVWDALDPTWSCAEKRRRLDPETL
RKLKSTYWLSRIVFLRALGFVYFFAFLIAFNQSQGLIGSDGILPASDYVAMVKDSFADAEAWQRVKAFPSLFLLFPATDF
WLHAIPFVGMILSLFMTIQGASNGFLLFLLWILYQTVNSVGQAWFSVGWEAQLLELGFLAIWMAPFWSFSRLPPSWPTPK
ICVWGNRWLVFRVMLGSGLIKLRTDRAWKDLTALDYHYETQPLPNPLSWYFQNQSHGVHAAQVVITHIVECVISFLVILP
FRQCRLFAGIVQIAFQVGILLSGNLAFLNYLTIVSAIMCLDDHFLTCLFPSAILSRLPELVRGCAGYWSLPQIQAWPFPQ
LFPGEEHGKGKGRQANDRPEAEASLLDKDAGRDETLPFNAATDDSLDSPRSCCCWYRPYFPRIVRSLKIPSRVRKQVKEE
IKENWGKMLAEVVASVAMLTCMAFVTNPATSAVWMVIAVFFLAIILSASSTFFTNTLVSNAFTELVLLIVTLWSCIAIYQ
HGPAVWSVWLTTCLFTVLIAFAYTTLTNAALIFKIHVEVLIFLLIAALSVPVVANLISPDQVMDSDLGNPFSVVNTHGAF
GYIGKERYELIIQGTNASSPTQTLYWQNYEFKCKPGDLYRRPCWAAPYHYRLDWLMWLASMGDKETVKDMHPWLSNFLSR
LLQNSKSVTGLLAHNPFQNSDPPTALRVLRIQYRFTKGPVFGGGPWWEVVPETRELFVAPSQVPGAAAHLRKQLLILRRR
EEKQRLEQRRKEEAEIRRKEEEAFKRRRERAMKEEERRKREAEEAEKRRIAEQARQAEDEKRIREQAEAARKAEEEAVRK
QIEEEKKRHEEEEKERQAEEERERREQQEEEEKRRAEDEKRRKEKEQATLLARQRSEEALKEAEKKARKDAEEEERKRKE
DALQEEKRQKEEKEAEEKRRKQAEARREAARAAAEKESEKARQLQEQEAKRKALEEQERRKARERQRSASSQVAVYTAQP
HDGGGVPLRHAPLLTRKKQAL

Gene-Specific Links for TGME49_115220

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins