ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_114820 ()

ATP synthase epsilon chain, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13337

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL7P1.75 mitochondrial ATP synthase F1, epsilon subunit, putative
  • PBANKA_142180 mitochondrial ATP synthase F1, epsilon subunit, putative
  • PY02879 hypothetical protein
  • PVX_122980 ATP synthase epsilon chain, mitochondrial , putative
  • PCHAS_142360 mitochondrial ATP synthase F1, epsilon subunit, putative
  • PKH_142260 mitochondrial ATP synthase F1, epsilon subunit, putative
  • TGME49_114820 ATP synthase epsilon chain, putative
  • NCLIV_057710 ATP synthase epsilon chain, putative
  • CMU_002850 hypothetical protein
  • BBOV_IV007710 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_114820 ATP synthase epsilon chain, putative
MWRSSGVSFTRYASEMAALLRQCLKEPYRTQAMQRNQIHLKETVYQQGQVLTRETFNDIKKAFEAAAKHAGEK

Gene-Specific Links for TGME49_114820

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins