ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_114500 (SUB2) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

subtilisin-like protease TgSUB2, a gene from Toxoplasma gondii

Compiled localisation
rhoptry during extracellular tachyzoite

Who localised this protein by microscopy?

Miller, S. A., Thathy, V., Ajioka, J. W., Blackman, M. J., Kim, K.
TgSUB2 is a Toxoplasma gondii rhoptry organelle processing proteinase. (2003 Aug, Mol Microbiol) PubMed / full text
   more detail about this publication

rhoptry during extracellular tachyzoite
  • "TgSUB2 localizes to rhoptries and associates with rhoptry protein ROP1, a potential substrate."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: Blast from AF420596.1, annotation matches, gene model inconsistent
  • Localisation record: rhoptry during extracellular tachyzoite
  • Other genes localised in this publication: rhoptry protein, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_39827

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_114500 subtilisin-like protease TgSUB2
MARRRPSAIATCFRMILAFFLSFTFSSGADSLLAPSTTQARRLQARSGDNALSNGGRLPNGEHNQFRALRRGDQKVEKDA
FGAVNAEQRTAVSGSKFEREKWTPISFTEKGLFDVINPTIAGDEKDELNWSTHQRIEGRGTEPTRSDSQQRDQAKPRALE
RREEAGQPPRDEHQDTDVEQAPLIKEDESDSPSVEEPRAQPPENKEDAITKPWDADWNPWKFLDENPLPIYRDDWDEEED
NRDDADHDPGFAEPPNSPPAGGVPKREDDNAPDYPGDDTASSPPYDMRPNPEDHSRTQPGEYGGGVDDEGELPDEDTAKG
MPRSSTPPPNEESIPAVPTESEWSGSGVYEGIAITVNARWIDTRTIGEGGIQLQHQPTVFPAPPVLRKVGLKSKWKHTIK
IFVRTTGAKFVPARRQVFVPLDETPTSSSTLLPWWANWSISAVKAASATTSSVAAFLFGTGRAVDGGEGISEGKGPTITS
IKNMLKQYKRFKRKHPGKPGELVIDLCKDEEDASSAARTPSPSSASESSSDGGVWESLESPAPAPMPSLTSSSPSGSSPF
VVKQSPEGDLKTESEGPARLTTPSEKRPAKAKPQNTKKKTKRRKRTVANAYNILQTQEGLALVNKIRDTMAEIFSSPSTS
VQVLTSTGHLVITLPSEGVDRYKLKGFLQTVQETFGDNIQQWSFSEIVQLRSEVPEPHIPPRAQMAAKMESLSGKSTKTS
KKLNGRSLPASMSETTSKKTPFEASMPTDSALESKLYGMHMITATHAWIHGEAGDGTVVAVVDSGISRHHDLDCNLWQNP
HEQQDGRDDDGNGLIDDNHGYDFQENKSEPEDENGHGTHVAGIIGACVNGGGVVGGAPKTQLMALRFIDKGGQGSMANSI
RALNYAIDHEVQVINNSWGGPQSTTVLRRLVHMSAVARNGKGILLINAAGNESSNNDVNPSYPANWDQDNTISVAAIDIN
GDLADFSNYGKSSVDMAAPGVKIYSTKPGGDYQHMSGTSMATPHVSAVAALVFGAFLRNGYDAPAAEVKDIIRITASPVE
QLQGVTRWGSIPHARDAVLMARMGGMFLQAKCEDMVFELDAGSAHVVDLHLMPYRQGNYTADLTFDVFTEDGYRLDQIKV
PVKLAISAEPRQGNSDSLAAAAFSSVVSTFAAHPTEGFEELCRLQAKIHVVQEMSTAMIVIICLGVIAAISVLVLVYCCS
RNGQRRSDAAKRRRESVRDSAGEERRNQLTETHRARKHADTSAEANKEFLNCSSRAEDDANDRSETHTNPTDPLCRKEHV
FLPATTLEQFALSTPNENES

Gene-Specific Links for TGME49_114500

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins