ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_114400 ()

branched-chain alpha-keto acid dehydrogenase E1 component beta chain, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11646

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_110420 3-methyl-2-oxobutanoate dehydrogenase (lipoamide), putative
  • PY03843 Drosophila melanogaster RE25729p
  • PVX_097790 3-methyl-2-oxobutanoate dehydrogenase (lipoamide), putative
  • PCHAS_110390 3-methyl-2-oxobutanoate dehydrogenase (lipoamide), putative
  • PKH_102840 3-methyl-2-oxobutanoate dehydrogenase (lipoamide), putative
  • TGME49_114400 branched-chain alpha-keto acid dehydrogenase E1 component beta chain, putative
  • NCLIV_057460 Transketolase central region, related
  • TP01_0956 pyruvate dehydrogenase E1 component beta subunit, mitochondrial, putative
  • TA06600 transketolase subunit, putative
  • BBOV_IV008190 branched-chain alpha-keto acid dehydrogenase E1 component beta subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_114400 branched-chain alpha-keto acid dehydrogenase E1 component beta chain, putative
MVAFPSLSAASAAARTNGFASFCKPGMACKGAGFVRFFSFFAPARGAAAGVSALQQFSRPAAAAALGSQFQQRRNVGGSA
IDFTVACRTSTETRKDLGPTTPMNVFTAVNSALHTALETDPTACVFGEDVAFGGVFRCSVDLREKFGQHRVFNTPLSEQG
IAGFGIGMAAVGYTAIGEIQFGDYILPAFDQIANEAAKFRYRSGGNWNCGKLTIRSTWGAVGHGGLYHSQSPEAYFAHAS
GLKIVVPRGPYQTKGLLLSSIRDDNPVVFFEPKILYRAAVDEVPTGDYELPLSHADIVKEGSHITAIAWGTQVHRLLKAA
QEVEKEGISVEVIDLQTILPWDVDTIVKSVNKTSRCLITHEAPMTMGFGAELASTIQEKCFFSLEAPIKRVTGYDTPFPL
AFEPFYLPDERKVAEALRELKQA

Gene-Specific Links for TGME49_114400

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins