ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_113580 ()

cytochrome b5-like heme/steroid binding domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11362

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI0885w cytochrome b5-like heme/steroid binding protein, putative
  • PBANKA_081910 cytochrome b5, putative
  • PY07000 cytochrome B5, outer mitochondrial membrane
  • PVX_099325 cytochrome b5-like Heme/Steroid binding domain containing protein
  • PCHAS_081940 cytochrome b5, putative
  • PKH_071540 heme binding protein, putative
  • TGME49_113580 cytochrome b5-like heme/steroid binding domain-containing protein
  • NCLIV_056850 hypothetical protein
  • BBOV_I004720 cytochrome b5-like Heme/Steroid binding domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_113580 cytochrome b5-like heme/steroid binding domain-containing protein
MSVPLGSFPSSQRPSMPPSSSAPLSQTLSPATSRSRPRRKYPCPAPSQAFSPASFSPSHSSSYSSSPCSPLSSSPSSSAA
SLPSLPASSVAPSLSPSASFLSKRGERGDRRSSPDALRPRHRWRSKSVGRQATPADAGEFLLASSNRGNAGDLLYTRGGR
AVPRAQAERDQSSPRRGEARGETEPSEEESDKAEARRGELGKKAHGRRGRRHDAGEQEGEGDASPERRGVADVPPKRRPR
RLRGPAELELVMTPLTGQTSRRGTAEEDPTTETEASREEPAEREAETHAKKGNARRLSRSRAKTETPGFVQKRDAKPGSE
EAVASERTRHVEWRRRRERERGSLRDSGKREARGASVPVSFASCASTDDACGGPQTADDTPQVVALYLLIQSFTTIQHPD
LLRPVLALLLLPRVPESLLRLCAAHLPPTPASYVALESPAQCAGRVELFLPDESADAAGAVEDENEAASRWRGCKPPQGG
GEAGRERRNSAVIRADGEMPQARGLKRELGSGASATTTANRPTGRAEGDPLRSRERETLVNGREEKETEGKREERRDEEN
NEEGGEKNLTPTLTDAEHEEFEGSTLSRSASASRPPLFASFSFERGGRSPAERASKEADSRRRGDARKRFSLSTGRTKEA
VSSSLPARASKFENAFVNASTASKAFRCTRASSGVSTTGGVSTTGGVSAPEASGEKGRTRDGEETSFLKRHDGHRGLQCG
GFCSSGTEQEEGVLSFPSAAQRDFGTCPSLSASAVLATRRPLLQKAQKEIQRAFEENLFFSLCSEDVSSPISRCQSRSES
HARQTVSAVWGGLGEGAGDGERGSEGCREGDSEGREEQPRRSGHWASEMGAEGRRPSWGSSRDSFPEEDEDTVWVTNPYR
RALEYFVGAEAASRRRRDTAVLLGGALLHAVLSHPTVTSEEWESVKNAPPFDSGALSRDARMLLPAAVAGMSSQGGSGAR
SGETGEPFLWREPMSSRESQRRAVHEWRVIRQLCKEVERVASIYHQVLGSSSLSPSPLRLHHLAEEASAVLLPQATSEEQ
KLYARLSREREKEREADACSEASEGDSSVSGDAQRDLHRRERGEGTAGQPRSEREEEEGDCVGGCSQVCGGASAGEKREG
GERKAAEKKGSRQRDSREGEATGEASWAGDGSSSAFSEGLDESRRAKISETRESYALLLKKEEDSKGNAFSAAVTPDLSV
GIAGVLQSEGRQVSVWLEGRNFIRCFVDTQEGLAPRYFLQSETHLLLVSPSPETPGRADVRMACPLAQVESRVDSTDTSR
LRLLVASSATPPGDAVWKRSSNAGDQLPERRHSRSSSFSTDGPMQASKQQRSALKSPALQVSSAAGAVVCHSSGALAGDS
SAPSIPVATPAEGLGARSDGPGSSSLSVLVGGKQSGLSRQIASSSPPWLSCSPSPKSGGTSREPSSSAHWELHLSFEDTL
RCCIVAKPGSLYRNLATLFRDAGREGRACTVGSQSRFRDLMAADKNRLAACSSGALRRISLEELSRHCSREDLWVALDGV
VYDISSYVSFHPGGARILVEHAGTDISEVFRQYHAWVNAKHILEYNRAVLHAGLRFAFA

Gene-Specific Links for TGME49_113580

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins