ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_113560 ()

60S ribosomal protein L7a, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11640

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFD0960c 60S ribosomal protein L7ae/L30e, putative
  • PBANKA_072190 60S ribosomal protein L7ae/L30e, putative
  • PVX_090080 ribosomal protein L7Ae-related protein, putative
  • PCHAS_073090 60S ribosomal protein L7ae/L30e, putative
  • PKH_052410 ribosomal protein L7Ae-related protein, putative
  • TGME49_113560 60S ribosomal protein L7a, putative
  • NCLIV_056830 60S ribosomal protein L7a, putative
  • cgd3_760 HMG-like nuclear protein, Nhp2p, pelota RNA binding domain containing protein
  • Chro.30105 nucleolar protein, possibly involved in ribosomal RNA pseudouridinylation, in association with snRNAs
  • CMU_042430 60S ribosomal protein L7a, putative
  • TA07115 40S ribosomal S12-related protein, putative
  • BBOV_II004250 ribosomal protein L7Ae-related protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_113560 60S ribosomal protein L7a, putative
MANEDGETAASKMTYLSPIASPLLDGKSLRRSLKLIQLAADRERAARGKQGKDEKAKSPQAKKGAKLLRRGVHEVTKCLR
KGVKGIVFFASDVFPIEIIAHLPILCEEKDVVYAYLCSKKTLGHAFRSKRPASVIMITPGEDMPEVDGEDSEEKFEEVYK
KVAKLVRKSNPYF

Gene-Specific Links for TGME49_113560

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins