ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_113410 ()

26S proteasome non-ATPase regulatory subunit 2, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11317

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFB0260w proteasome 26S regulatory subunit, putative
  • PBANKA_030360 proteasome 26S regulatory subunit, putative
  • PY01123 Proteasome/cyclosome repeat, putative
  • PVX_003730 26S proteasome regulatory subunit, putative
  • PCHAS_030580 proteasome 26S regulatory subunit, putative
  • PKH_041390 proteasome 26S regulatory subunit, putative
  • TGME49_113410 26S proteasome non-ATPase regulatory subunit 2, putative
  • NCLIV_056700 26S proteasome regulatory subunit rpn1, related
  • cgd8_570 proteasome regulatory subunit S2 (RPN1)
  • Chro.80073 26S proteasome regulatory subunit S2 (RPN1)
  • CMU_024510 proteasome/cyclosome repeat family protein
  • TP01_0709 26S proteasome regulatory subunit 2, putative
  • TA06145 26S proteasome regulatory subunit, putative
  • BBOV_IV009920 proteasome 26S regulatory subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_113410 26S proteasome non-ATPase regulatory subunit 2, putative
MANDENKKLVAIQASAKDPTQTGKEGKEKNGDKKKKVEDELTEEDKKIKEDMELLVERLQDPEPGVVALALQTLSVQLKA
ATSSMTSVPKPLKFLRPHIPVLIAHYHRLAPDDKIKPDFAMVLAVLCTTCGDGQRRSLHFCLEGGCRDIASWGFEFLRNL
AGEVAAAFADIHGEEKKAGAVEEDLLASSDAAAGSPESPAPGETKAGEAKKPAEEEAKTKKPSLALQISMVVPLPTLAQL
NAVVDLIVPYYMTHNAECDAIDLLSEVERVESVAAHVDSNNFQRVTLYLLAMANYAASLEEYTRVLGVAYTILLDQKQWF
DAMRVALKMPNSDAEKTEKIQAVVEQCRAAGDPLMVKQLALLLGRQGVDFDFEDEQTQRLNSGEELSNFFLLLAKEMDVL
EPKTPEDVYKTHLEDGASRRGAAAALDSAKQNLASTFVNALVNAGACKDKLMLADGGSWLYKNKEHGMMSAAASLGAILL
WNVDEGLSHLDKYQYSSDANIKAGALLGFGVLSSNVRHECDAAFALLKDHLEDSAEGGRSAPCQKVGAVVGLGCAHAGTK
RVDVMEALTVVIVDSSLPVECSAFAAVSLGLVFVGSCNQEAAEAILTTLIDRSSVEKGLDSPLCYYFALGLGLLFLGARD
ACEPTLTALEALGSAAPAETQLRTCLLAAYAQRTVEGLAYAGSGDVLKAQKFLSFCGEARDKQYWADLLNSKSGEEAEKK
EENGQEEKKEDKEKQEKQEENEKKQEKEKKETDVGGVTGATRARNLAGSEDEEDEEDGRKLDQAVAVMNLALLAFAEDVG
AEMSLRMMDHLLQYADLPQRRAVPLALALHSPSRAKPGVIDTLSKLSHDADADVALNAIFAMGVVGAGTNNARIAGLLRS
LASYYGRDGNALFVIRLAQGLLYMGKGLLTINPLHSDRFLINNVALGCLSVIMHTCLHMRTTILGKYHYLLYYLFPAMQP
RMLFTVAPVSQLPQAQPSAESAESPESSAGVPTAGAAGETEETMEKEVDVAEEELKMACLSARVGEAVDIVGQVGRQPKT
ITAFQTHTTPVLLSYSERAELATDEYVPLANVLEGVVIVKKNPDFRPATTA

Gene-Specific Links for TGME49_113410

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins