ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_113230 ()

eukaryotic translation initiation factor 2 alpha subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10882

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF07_0117 eukaryotic translation initiation factor 2 alpha subunit, putative
  • PBANKA_021210 eukaryotic translation initiation factor 2 alpha subunit, putative
  • PY00093 eukaryotic translation initiation factor 2 alpha subunit
  • PVX_081705 eukaryotic translation initiation factor 2 alpha subunit, putative
  • PCHAS_021050 eukaryotic translation initiation factor 2 alpha subunit, putative
  • PKH_021240 eukaryotic translation initiation factor 2 alpha subunit, putative
  • TGME49_113230 eukaryotic translation initiation factor 2 alpha subunit, putative
  • NCLIV_056550 Translation initiation factor 2 subunit alpha (AeIF-2a), related
  • cgd7_5270 Translation initiation factor 2, alpha subunit(eIF2-alpha); S1-like RNA binding domain
  • Chro.70587 eukaryotic translation initiation factor 2 alpha subunit
  • CMU_019420 eukaryotic translation initiation factor 2 alpha subunit family protein
  • TP01_0853 eukaryotic translation initiation factor 2 alpha subunit, putative
  • TA06015 eukaryotic translation initiation factor 2 alpha subunit, putative
  • BBOV_IV009190 translation initiation factor 2 alpha subunit
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_113230 eukaryotic translation initiation factor 2 alpha subunit, putative
MEARDGTSSQGATGAAVPKADLGDCRFYEERFPDVEDLVMVKVNRIADLGAYVSLLEYNNMEGMILMSELSKRRFRSVNK
LIRVGRHEVVMVLRVDPKKGYIDLSKRRVSPEDIVKCEEKFSKSKKVHQTVRHAAQKHGMKVDDLNRSVIWPLYRKYGHA
LDALKEAAMRPDEVFAGLEVDEEVRKSLIQDIQLRLAPQALKLRARVDVWCFGKQGIDAVKAALQAGQEVGDDEVTINIK
LIAPPQYVVVTSCYDKELGMRKIEQAMKAISDKIKSFSGGDFKQQGEIVVMGGDEEKRLEELLEEANEDDSSDDEEEEED
EGMGRVEDDIPEDEVEDDEEDNDDGNA

Gene-Specific Links for TGME49_113230

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins