ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_113140 (ICDH2, Isocitrate-dehydrogenase I (IDH1))

isocitrate dehydrogenase, putative, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during intracellular tachyzoite and tachyzoite

Who localised this protein by microscopy?

Fleige, T., Pfaff, N., Gross, U., Bohne, W.
Localisation of gluconeogenesis and tricarboxylic acid (TCA)-cycle enzymes and first functional analysis of the TCA cycle in Toxoplasma gondii. (2008 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

mitochondrion during tachyzoite

   17784785 (unpublished) full text
   more detail about this publication

mitochondrion during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10559

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF13_0242 isocitrate dehydrogenase (NADP), mitochondrial precursor
  • PBANKA_135860 isocitrate dehydrogenase (NADP), mitochondrial precursor, putative
  • PY00592 isocitrate dehydrogenase, NADP-dependent
  • PY02505 isocitrate dehydrogenase, NADP-dependent, putative
  • PVX_083185 isocitrate dehydrogenase [NADP], mitochondrial precursor, putative
  • PCHAS_136320 isocitrate dehydrogenase (NADP), mitochondrial precursor, putative
  • PKH_120870 isocitrate dehydrogenase [NADP], mitochondrial precursor, putative
  • NCLIV_039280 Isocitrate dehydrogenase-like protein, related
  • NCLIV_056480 hypothetical protein
  • CMU_033490 isocitrate dehydrogenase, putative
  • TA10850 isocitrate dehydrogenase, putative
  • BBOV_III007260 isocitrate dehydrogenase, NADP-dependent family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_113140 isocitrate dehydrogenase, putative
MASALRRITARAASPAFPFTSLQSSTFARALSTKSACVRPQLLSSALCNTVSSTSSSASSGLAVSPVQKSGNPDASPRFF
ASAASVATGGAFNLEGKIHVANPVVEMDGDEMTRILWAWIKEKLLFPYVEIPLEYYDLSVTNRDQTEDKVTLEAAEAIKK
CHVGIKCATITPDEGRVKEFNLKKMWKSPNGTIRNILDGTVFRAPILISNVPRLVPGWKKPIVIGRHAYGDQYKAESLVC
DGPGDFTISFTPAGGSRVEKKVFSFSGPGVMLGMYNTEDSIRGFALSSFKFALQQNMPLYLSTKNTILKQYDGMFKDIFQ
SYYDEQFKPLFEKQGIWYEHRLIDDMVAQALKSEGGFVWACKNYDGDVQSDIVAQGYGSLGLMTSILVCPDGKTVVSEAA
HGTVTRHYRQHQKGQKTSTNPIASIFAWTRGLAHRAKLDGNDRLGQFCLALEHACIQTVENGAMPKDLALCVKGADKVTA
SDYLTTEEFMDAISDTLKMNLITRQAPHADQGVGGRP

Gene-Specific Links for TGME49_113140

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins