ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_112600 (Hsp21)

small heat shock protein 21, a gene from Toxoplasma gondii

Compiled localisation
cytosol and not nucleus during bradyzoite and tachyzoite

Who localised this protein by microscopy?

de Miguel, N., Echeverria, P. C., Angel, S. O.
Differential subcellular localization of members of the Toxoplasma gondii small heat shock protein family. (2005 Dec, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytosol and not nucleus during bradyzoite and tachyzoite
  • "Using the anti-Hsp21 antibody, the signal in tachyzoite and bradyzoite stages appeared throughout the cytosol of parasites but not in the nucleus"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: PK
  • Gene model mapping comments: blast from AY756061, annotation matches
  • Localisation record: cytosol and not nucleus during tachyzoite
  • Other genes localised in this publication: small heat shock protein 20, heat shock protein 28, Hsp20/alpha crystallin domain-containing protein
  • "Indirect immunofluorescence localization of Hsp21. Tachyzoites (upper panel) and bradyzoites (lower panel) were stained with rabbit polyclonal antibody anti-Hsp21 and mouse polyclonal antibody anti-H2A.Z histone to evidence the cytosolic localization of Hsp21"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: ME49
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytosol and not nucleus during bradyzoite
  • Other genes localised in this publication: small heat shock protein 20, heat shock protein 28, Hsp20/alpha crystallin domain-containing protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_93537

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_112600 small heat shock protein 21
MASPTSASSKAPGTESEACGHRHPGHVGATHTYNWDEFRQFLDSQGSLWHSAVLGAPASAAPNTIFELAPTAAEAGRAIA
FRPRLDAYYDTAAHKIVMLFDLPGFEKKDISVEVTDHAIIISGTRDRLNDKVLYGEKSRELIKERAFGHFCRKFQLPTNA
VEDAVTAAMTGGVLEVTVETREEEASHTKKKIQIA

Gene-Specific Links for TGME49_112600

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins