ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_112520 ()

tRNA delta(2)-isopentenylpyrophosphate transferase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10507

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL0380c tRNA delta(2)-isopentenylpyrophosphate transferase, putative
  • PBANKA_060610 tRNA delta(2)-isopentenylpyrophosphate transferase, putative
  • PY04164 tRNA delta(2)-isopentenylpyrophosphate transferase, putative
  • PCHAS_060790 tRNA delta(2)-isopentenylpyrophosphate transferase, putative
  • PKH_130650 tRNA delta(2)-isopentenylpyrophosphate
  • TGME49_112510 hypothetical protein
  • TGME49_112520 tRNA delta(2)-isopentenylpyrophosphate transferase, putative
  • NCLIV_056050 hypothetical protein
  • cgd6_2540 tRNA delta(2)-isopentenylpyrophosphate transferase, putative
  • Chro.60293 tRNA delta(2)-isopentenylpyrophosphate transferase
  • CMU_007290 tRNA delta(2)-isopentenylpyrophosphate transferase, putative
  • TP01_0445 tRNA delta(2)-isopentenylpyrophosphate transferase, putative
  • TA20750 trna delta (2)-isopentenylpyrophosphate transferase, putative
  • BBOV_IV006320 hypothetical protein
  • BBOV_IV006330 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_112520 tRNA delta(2)-isopentenylpyrophosphate transferase, putative
MEERILRSSCLLSERIHSCGSKGERRTVPHSTSMSAGCSGIFSEKLPKKFSERLLPLRLSVTSVQEDKRHFEESASFAPA
SGFASPASPSTSLSTFPSFLLSLSACASLPPSISSSSTQASSTSPSSSSTLSSSFSSSSLPASSPASPSRSSASASPSSS
VSSVAPPLASAVPSRGVVFILGPTGVGKTRLSVEVALALQRRGQAAEIVSADSMQVYKGCDIATAKASVEEQKQVPHHLL
DICDVDSHFSVLRFLQLATQTIEALHARGVLPIVVGGTQLYLQHLLWRSLLDRYLHEDLESEMQDKSSGSCSPLDGFSTE
TLYAELKKLDPERTTQSTGVPHSELMRREREASIREGLRYPSCILWLDCRDEAVHRRRLEKRVEQMLQAGLLQECEWLLD
TLGLYEGRGEGARVSDSTAPEEGAKETGREPEKKRVKTTAERGVSSDGNATAATVPGDAKGDTTLVETSGDSACEDRASR
KAEPAAGGETRLPGVLQSIGYKEFIPFLLHQRQKQRQQTPTASTSASTGSSSCSSSSTLSDSSSCRFGCPAGTLCPPTLA
SAAACLVTRSCQYAKKQRRWIVNKFLLRQQHLPLYLLDTSHAENEQAWHDETHEPAIRIVHEFLNNKPFTEDHPHAAAAH
LSEAEKAKRERLKALSGQASGVASTIGKDPWVDGGLNRPRTCTLCNRTCIGETDWLDHVKSKAHRARTKKENAGKKDLDN
TEEQETKAIEVSISANEKSEC

Gene-Specific Links for TGME49_112520

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins