ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_112270 (ROP13)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
rhoptry body during tachyzoite
not rhoptry neck and rhoptry during tachyzoite

Who localised this protein by microscopy?

Saeij, J. P., Arrizabalaga, G., Boothroyd, J. C.
A cluster of four surface antigen genes specifically expressed in bradyzoites, SAG2CDXY, plays an important role in Toxoplasma gondii persistence. (2008 Jun, Infect Immun) PubMed / full text
   more detail about this publication

rhoptry body during tachyzoite

Gilbert, L. A., Ravindran, S., Turetzky, J. M., Boothroyd, J. C., Bradley, P. J.
Toxoplasma gondii targets a protein phosphatase 2C to the nuclei of infected host cells. (2007 Jan, Eukaryot Cell) PubMed / full text
   more detail about this publication

rhoptry body and not rhoptry neck during tachyzoite
  • "Rhoptry localization within the parasite was confirmed by colocalization using antibodies to the rhoptry protein ROP13."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RHhpt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry body and not rhoptry neck during tachyzoite
  • Other genes localised in this publication: Rhoptry kinase family protein ROP2A (incomplete catalytic triad), hypothetical protein

Bradley, P. J., Ward, C., Cheng, S. J., Alexander, D. L., Coller, S., Coombs, G. H., Dunn, J. D., Ferguson, D. J., Sanderson, S. J., Wastling, J. M., Boothroyd, J. C.
Proteomic analysis of rhoptry organelles reveals many novel constituents for host-parasite interactions in Toxoplasma gondii. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115878

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_112270 hypothetical protein
MKRTELCIAALVAVGAFAFTSPNAVAKSFERSLGHLDASSFLSSPLNSDVELGRSTFPAQSLSFTEGTNETNPPTSRPPG
WKYEGSDLQRRVAARREEHKKRQEEWEQRKASRRSALTPSAPDPDGDGDPATSFPSQRRLLDRCLQQFREQLVDLENLCK
GSPEPDDCRSTVQEILGKQSFGALHTTVISFSIFVNRDPRRLSFPVLDATDLRLTVKLKHLLDRIPGCAALSLPVYIGLV
SSDVFKSEEFTRKVNRCSEDFGRSAREEPSRAGRAAAAVIRFMGLTPERQTFYQPFMFVTTQAAMLLSMVLKHPFLSILV
NMACVAGSLCRKGIREVLLRALREADFLTEDVPLDSAPQELVDHLKVYLKLLFLRKYRRLRRQAANVAAQVVYANSLRLL

Gene-Specific Links for TGME49_112270

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins