ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_112200 ()

serine/threonine protein phosphatase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11778

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_113190 serine/threonine protein phosphatase, putative
  • PY04697 serine/threonine protein phosphatase PP5
  • PVX_114750 serine/threonine protein phosphatase PP5, putative
  • PKH_111550 serine/threonine protein phosphatase, putative
  • TGME49_112200 serine/threonine protein phosphatase, putative
  • NCLIV_055800 Serine/threonine protein phosphatase 5 (EC 3.1.3.16), related
  • cgd2_2960 phosphoprotein phosphatase related, putative
  • Chro.20310 phosphoprotein phosphatase -related
  • CMU_030510 serine/threonine protein phosphatase, putative
  • TP02_0944 serine/threonine protein phosphatase, putative
  • TA15975 serine/threonine protein phosphatase, putative
  • BBOV_IV000160 serine/threonine protein phosphatase 5
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_112200 serine/threonine protein phosphatase, putative
MAEGEGVSGEAATSQDTRAAGEASRPERSQAAVEDLRQAENVNSEEEAAMEECFGDMVAEAESLKTEGNEFFKTRLFHQA
VEKYTAAIDLICSNTMTAQTKQILQVLLCNRAFCQINLENYGSAVVDAERVIQMNPLFAKAYYRRGCAYCCLSRYKKAQK
DFERVIALSATPDPSVVSRLNECKKQIRLEAFAAAIETQQTMRASEAVRKEGLDTLCPVEKSYDGPVYAPTGSEYCSAEF
VGALKEFLKDTSKRLHKQFAYRMVLDVISLLGKLQTLERIRIPDDGEITVCGDVHGQYYDLCNIFELNGMPSKENPYLFN
GDFVDRGSFSVECILLLYAAKLAFPDAFHLTRGNHETFEMNRLYGFRGEVLHKYDERLYNLFCESFRLLPLAFVLNDAVF
VVHGGLLSRDDVTLEEINKIDRDREPPDGGLMTDLLWSDPSPLPGRSPSKRGVACQFGPDVTAAFLKRNNLKLVIRSHEM
KDDGYEVCHNGQLVTVFSAPNYCDQMKNKGAFVRLDGKTLTPKYTQFEAVPHPATRPMQYANPMLSFM

Gene-Specific Links for TGME49_112200

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins