ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_112110 (ATrx1)

nucleoredoxin, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast intermembrane space during tachyzoite

Who localised this protein by microscopy?

DeRocher, A. E., Coppens, I., Karnataki, A., Gilbert, L. A., Rome, M. E., Feagin, J. E., Bradley, P. J., Parsons, M.
A thioredoxin family protein of the apicoplast periphery identifies abundant candidate transport vesicles in Toxoplasma gondii. (2008 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast intermembrane space during tachyzoite
  • "In this report we identify a novel apicoplast-associated thioredoxin family protein, ATrx1, which is predominantly soluble or peripherally associated with membranes, and which localizes primarily to the outer compartments of the organelle. As such, it represents the first protein to be identified as residing in the apicoplast intermembrane spaces. "
  • Microscopy type: Light, EM
  • Microscopy method: HA tag
  • Strain: RH
  • Gene model mapping comments: taken directly from 18586952, but gene model in toxodb 5.0 is inconsistent with GenBank entry, Blast from EU555314
  • Localisation record: apicoplast intermembrane space during tachyzoite
  • Comment: Possibly some alternate splicing? Didn't read the paper properly enough to know fully
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11624

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_112110 nucleoredoxin, putative
MAPDSCRPDPVGAPNGRGSLKEVSSSFCTTSSLFSRLSLLFLLFSLFASPRQLSLTSAISLEPSPGSPAAAQVSSGVAPT
PVEKESGNGGQVKVHLKRDEAGRPLPVSAASLFAAEKPHEEEEREVLRVGVDAGDSRREKRAVEPTRMLASIDPQHPSVS
AQVVSPAPSSSLTAPPTARPRDEGNNTCVRNNETCQRRERYAEKSIQRHRHDSTSSRESVAFASFGSSKNSFATAYAPFD
DEDEEGALAHLKNKVKTAVSCPAAKILLGISGVVALGTLGIKYTRNVLRRRRREGLQRPPTPFTDLLGHVLLKRERGKHA
AETRELATGDVLGKPGSVTALYFSGRGVEEMLQTRGYQPFTPRLERIVEGCRERGQELNVVYLSADADSSDAEKHFSDMS
WYALPFDDAPGQARIHRLFRKFRVSTLPHVVLLDSNARVLNSHAYASMIVRPTAFPWKKQTPAELLGDAFVAGEGQKVGK
DALDNNVVGIYFSASWCPPCQAFTPKLVEALKGWKEQGKDVSVVFVSNDRDEKAFEEYFKKMEGFVAIPFADTTRRALLQ
EALNVRSLPTLVWLSKEGEILTRRGVPHVLEDPEGRNFPWKDKDVNDVSDSVEGIADEPALILFMEHLDEKAKEEQEKAL
EEAMQALQSQKNDGGVPPLPRLFTAKSLSPRSIALRRICRQDPPDADKEKKGPILTIVDLLDQSYFTALQEPGRIFSADE
IVAFINKFRREELERNSLAVPE

Gene-Specific Links for TGME49_112110

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins