ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_112100 (A1, PMCA)

Ca2+-ATPase, a gene from Toxoplasma gondii

Compiled localisation
acidocalcisome and parasite plasma membrane during bradyzoite and tachyzoite
not dense granule during bradyzoite and tachyzoite

Who localised this protein by microscopy?

Luo, S., Vieira, M., Graves, J., Zhong, L., Moreno, S. N.
A plasma membrane-type Ca(2+)-ATPase co-localizes with a vacuolar H(+)-pyrophosphatase to acidocalcisomes of Toxoplasma gondii. (2001 Jan 15, EMBO J) PubMed / full text
   more detail about this publication

acidocalcisome and parasite plasma membrane during bradyzoite and tachyzoite, not dense granule during bradyzoite and tachyzoite
  • "Indirect immunofluorescence and immunoelectron microscopy analysis indicate that TgA1 localizes to the plasma membrane and co-localizes with the vacuolar H+-pyrophosphatase to intracellular vacuoles identified morphologically and by X-ray microanalysis as the acidocalcisomes."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AF151371
  • Localisation record: strong acidocalcisomes and weak cell surface during tachyzoite and bradyzoite
  • Other genes localised in this publication: 28 kDa antigen, H+-translocating inorganic pyrophosphatase TVP, putative
  • "Indirect immunofluorescence and immunoelectron microscopy analysis indicate that TgA1 localizes to the plasma membrane and co-localizes with the vacuolar H+-pyrophosphatase to intracellular vacuoles identified morphologically and by X-ray microanalysis as the acidocalcisomes."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ME49
  • Gene model mapping comments: inferred from another publication
  • Localisation record: strong acidocalcisomes and weak cell surface and not dense granule during tachyzoite and bradyzoite
  • Other genes localised in this publication: 28 kDa antigen, H+-translocating inorganic pyrophosphatase TVP, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10126

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_112100 Ca2+-ATPase
MEDWKEQFRVVPRLFRDKWAAGLLDYVVRSPGLLISFLVLAVGQLFLTFFFLQLFRAPLLFTWWQQTSSLLCAFVLGEFG
ASFHDFRYFPRLQLPSTQSFLDFLPCSLSYCLFMLFSNVLISHIPNPLYLPVVSAVAVGLTQVFHFFGCSTAPEPTPLRA
LSVSLLVFPALICCVVSGSQFFLFALLSTAATVLFRACFLPKALHAASGRGAELNLCQNLTGALLLSLPALLVSDCPPTL
TFSPFSLDLRNWQVGGCWVAVAVLPFFRNVIGNRLMRDGGADVWRAAEILALLLASFVAALFLPASLAFCATYAMVLAGR
LLGCLDSLAADEKRGHLRRALIREAPDSEDENSCSDEPVLFVYSDGPATSFAQGSPSDLWPDDEDKEVFAERRAQLIDIV
HAYVTRVHHEDVDMIDEMGGVRAIASALGSDLADGLPILKRHDSSLRASSFDGAAAIRESSQGFETVVVRTLGSLQTGDA
ATGVTLGRSETREAPQRPRCLQTRPAGSDADPLTGLASQESWITRLLRRSIGSEQGGDLVQTQQRRFGVNRIPHRPLTSF
WTLLIEAASDATLRVLMLCGLLSVVLALLFSKEPEVEILEGIAIWVAVLVVVVVTAGNDWMKEQQFAKLSVVKDDKRCTV
VRSGHKEQISVFQLVVGDVLHLEAGDEVPADALVVQGRDLTVDESSLTGESDMIRKAPFQQCLNEALSRETAFSSALDSA
ENLPAPGSSVDHRRRSRGSFGAPSSGAPLQAQTCTTSSACADTLKSEGGVCRQLELARHHEVASPVLLSGTTVSTGSGTA
LVVAVGRYSQVGQMFQKLAYDAEPTPLQRKLNALAEDIGTFGLISAVVAFFVLLLEFWVMYFLQDPSKRESAVDVVHDHV
EFFVTAITMLVVAVPEGLPLAVTISLAYSIGQMLRDQNYVRRLAACEIMGGANEICSDKTGTLTKNQMTVTQFWDGEKTF
CIPSSRGEQTPGADPLSMAAEGEDVADDMSLHAQDASRRGYIPLSAHSTAASSASPHFAKSSCGGAAVSEGLAELQEKNF
KWEVLMQAIALNSTAFLETEEVVVAQGTGEETRFTQVKHVGSPTECALLAFQDEHCGGDYASTRRLYLGEDEVELIARED
FSSDRKMMTSVVRILKNSGDSTGETSPASPGLLRVFVKGAGERVLAQCSSVLVADQVIPLTPERKAEVEKTVVDAMAAEA
LRTICLAYRDIDPEREPDWRERCAAPHQMFMKGETQLTCLGIAGIEDPVRDEVPGAVAQCQRAGIKVRMVTGDNIITAKA
IAKRCEIFHEESGGLAMLGPDFTRAIGGVVCQTCQTEVCACATDAKTAEEQNKPLRVDVVRDLDAFDKIWTRLEVLARSQ
PSDKYALVTALKQKGRVVAVTGDGTNDAPALKKADVGFAMGLSGKEVAKQAADIVMLDDNFTCIVKAVKWGRNVYDNIRR
FLQFQLTVNVVAVALTVVCTAVQREAPLSAVQMLWVNLIMDSFASLALATESPTDDLLNRKPQGRDSYLISRSMLTSIVA
ASIYQLTVMIGLIFFGERFLPETKWTFLSDEDRRNLGFCEFSDCDFGMYTGTRMLSGRRYKLFSTEDDYKLEWLREVGPS
RHGTFVFNTFVFMQIFNTINARDVDDTQIEKSTSLSAAILGMVRNPLGLGIWVLIVLGQVLMTECGGRLLGCHQEGLNRE
QWMLSLLLGLGGLLWGRLPRVFPSLYKLAPEFGSREETLEETHSLALELRGRTPERMNERLGLASYTFAKKYAKKARLMT
LSRLRTRRLEGGRDGRGRGVSSFAGIRNRGASRGDARVAPRQNKACSPPLSDAREEACIEMQ

Gene-Specific Links for TGME49_112100

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins