ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_111720 (BiP)

heat shock protein 70, putative, a gene from Toxoplasma gondii

Compiled localisation
endoplasmic reticulum
nuclear envelope during tachyzoite

Who localised this protein by microscopy?

Yung, S., Unnasch, T. R., Lang-Unnasch, N.
Analysis of apicoplast targeting and transit peptide processing in Toxoplasma gondii by deletional and insertional mutagenesis. (2001 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum
  • "Panel (B) Reactivity of antibodies of the ER marker protein BIP in transfected cells"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER
  • Other genes localised in this publication: ribosomal protein S9, putative

Hager, K. M., Striepen, B., Tilney, L. G., Roos, D. S.
The nuclear envelope serves as an intermediary between the ER and Golgi complex in the intracellular parasite Toxoplasma gondii. (1999 Aug, J Cell Sci) PubMed / full text
   more detail about this publication

nuclear envelope during tachyzoite
  • "Cloning and sequencing of the T. gondii homolog of the chaperonin protein BiP identifies the carboxy-terminal amino acid sequence HDEL as this organism's endoplasmic reticulum-retention signal. Appending the HDEL motif to a recombinant secretory protein (a chimera between the parasite's major surface protein fusion, P30, and the Green Fluorescent Protein) causes this secretory reporter to be retained intracellularly. P30-GFP-HDEL fluorescence was most intense within the nuclear envelope, particularly at the apical end."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: RH
  • Gene model mapping comments: Blast from AF110397
  • Localisation record: nuclear envelope during tachyzoite
  • Comment: Localisation wasn't shown directly for BiP, only the HDEL at the end attached to another protein – this is sufficient evidence.
  • Other genes localised in this publication: coatomer beta subunit, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10057

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_111720 heat shock protein 70, putative
MTAAKKLSLFSLAALFCLLSVATLRPVAASDAEEGKVKDVVIGIDLGTTYSCVGVYRHGRVDIIPNDQGNRITPSYVAFT
DDDRKIGEAAKNEATINPTNTLFDVKRLIGRRFNEKEVQKDKDLLPYEIINKDGKPYIRVMVKGEPKVLAPEEVSAMVLT
KMKETAEQFLGKEVKNAVVTVPAYFNDAQRQATKDAGAIAGLNVIRIINEPTAAAIAYGLDKKNEKTILVYDLGGGTFDV
SVLVIDNGVFEVLATSGDTHLGGEDFDQRVMDHFIKLVKKKYDKDLRTDKRGLQKLRREVERAKRALSSQHQAKVEVENL
MEGVDFSETLTRAKFEELNSDLFQKTLKPVKQVLEDADLQKSQVDEIVLVGGSTRIPKIQQLIKDFFNGKEPNRGINPDE
AVAYGAAVQAGILSGEGAQDMVLLDVTPLTLGIETAGGVMAKIINKNTVIPTKKTQTFSTYSDNQSAVLIQVYEGERPMT
KHNHLLGKFELTGIPPAPRGVPQIEVTFDVDRNGILSVSAVDKGTGKSEKITITNDKGRLTPEEIERMISEAEKFAEEDK
KVKERVDARNALEGYLHSMKTTVEDKDKLADKIEEDDKKTILDKVTEAQEWLNTNPDADAEETRDKLKDVEAVCNPIISK
VYGQSGGPGAGGAAGGADDDDYGGHDEL

Gene-Specific Links for TGME49_111720

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins