ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_111670 (TSA1)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during intracellular tachyzoite
during not bradyzoite

Who localised this protein by microscopy?

Pollard, A. M., Skariah, S., Mordue, D. G., Knoll, L. J.
A transmembrane domain-containing surface protein from Toxoplasma gondii augments replication in activated immune cells and establishment of a chronic infection. (2009 Sep, Infect Immun) PubMed / full text
   more detail about this publication

parasite plasma membrane during intracellular tachyzoite, during not bradyzoite
  • "Immunofluorescence shows the protein on the parasite surface even in activated macrophages, co-localizing with a tachyzoite surface antigen SAG1, and oriented with its C-terminal end external."
  • Microscopy type: Light
  • Microscopy method: HA tag
  • Strain: 4100
  • Gene model mapping comments: taken directly from publication
  • Localisation record: surface during intracellular tachyzoite, not during bradyzoite
  • Other genes localised in this publication: SRS29B (= SAG1, P30)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115857

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_111670 hypothetical protein
MLCVEVLELLLYSCLHEYCCCGRGGSSNCVERGSQGNDGVDSVIYGAEEDGCPCKQIRNILVVSLCDGGIVAAAVSSSHT
RPFAAKALAFPPSHFSPTCMLASETKVTQQPADAAVSPQPMQSSTQPLQIPGEREHPRRGPIESQHNGAQTIAALLASLY
DEFFYALSEQPTLGRRFCCGDGMRCPIRCPQPREPKQGSAGPNGEEAQEEDEAKRNTARVEPYTLSDSALSGFLEPADEL
PVLVVSRDRDKAAVGPFFVREGELPPEEEAKRLAQLQRGKDARRRMDEHGEVERTGRGQSARTPAGEEGRGADFDAALSP
GNSAGLSEGKVRGTFERKEGEGREGRLVEDTCISTGASEAPCGTISEQSAPTSLNASQTAAGNRDTSTRSCPGTELEQEV
GVEVPLVLIVWGTEKAREGLLLQTYDRARRLLSRKMVGLA

Gene-Specific Links for TGME49_111670

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins