ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_111510 (IF2K-B) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

PIK3R4 kinase-related protein (incomplete catalytic triad), a gene from Toxoplasma gondii

Compiled localisation
cytoplasm during extracellular tachyzoite and intracellular tachyzoite

Who localised this protein by microscopy?

Narasimhan, J., Joyce, B. R., Naguleswaran, A., Smith, A. T., Livingston, M. R., Dixon, S. E., Coppens, I., Wek, R. C., Sullivan, W. J. Jr
Translation regulation by eukaryotic initiation factor-2 kinases in the development of latent cysts in Toxoplasma gondii. (2008 Jun 13, J Biol Chem) PubMed / full text
   more detail about this publication

cytoplasm during extracellular tachyzoite and intracellular tachyzoite
  • "about 86% of TgIF2K-B labeling was detected in the parasite cytoplasm. "
  • Microscopy type: Light and EM
  • Microscopy method: antibody directly to protein
  • Strain: RH and ME49
  • Gene model mapping comments: blast from EU369393.1, gene model inconsistent
  • Localisation record: Cytoplasm during free tachyzoite and invaded tachyzoite
  • Other genes localised in this publication: protein kinase (incomplete catalytic triad)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_61930

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • NCLIV_055400 PIK3R4 kinase-related protein (incomplete catalytic triad), putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_111510 PIK3R4 kinase-related protein (incomplete catalytic triad)
MAVFLREVLCLRRLDAHPNIVRYFNSWVEVSPPPLTPENAIDHTSPLASQDQVPVGAKTTCVRSPLRPSMRGHLAGHKIK
VFKDDTLRWNEAEGGDAGEGSDEKMSQTPQIRYSSCGLDPECEQVCDRNPDHGGRNQNRVQAFSGSQLITACNGALAEED
KEVTDKSKMPGPCPSRDRPPCVSFPTGRPKMSTRSTIQIGHNKHMTLPPTTLTVTGARLRSCSNCPRGANAPFENTQRAC
LRKEGLPCKVTEFFPVQHGCSDLCAESPEEVDRRVRRTTTKESGKKGEGKNADSHSAGAGWAAMRGETRNGTCRRNHVSE
SLNAELETISKDFLRLHNTVSRRLVVSNTHDGNDDVLPPSCNDQSYALGQETGASATDCERWSDGGTQEQEADSREAPRD
KENWGYDVAKQWTEDVGKQETEEESVHRNGQGTSIAFQNVGHAFACINSNRNDEVKGLEIALEAREEREDAHRPWTRHTG
DMQSPPDGETSPKAREKGGTYNAPSWYRDPGKSGGEALRDKDDKYSYTTGKHPPESSSTVWSDGHTVTGADWTSVRTESR
PAVRESIRNMGKKDGTKILVCDDFWPCYEFYSDDNGEDGLQIVFAEVDPGGVVSCTRKDGVQENEENAAGLKCTVDVTSR
SSGVPPVSENTLVVSTQHSPTGKSDIRSRETERRGSGMVEMGERLMNQMANEVILQEKVCPFLQPSSRMPWDISLFAVGG
VAASDKGEGTPESYRNHHATMSMADMKERSYKPRTRRHSCGYPRYPKERLCARRGRSQSFTASSDRLPDEAVVESKEEAQ
HTPVQGTAAKAVDVRERRNLEETASAGLKQSAIGTHAVLTECHRSTIHDDGNGVSIRNQDVSLPSPRLSYHRKRHPSPQP
LTGGVNSSETLRYKRLPQSERQGNGRQETTVVNLRRCREAIKGVQSKEMRGRVRAKANTSQNIPDLSLSRRHFLGLSYPC
ERNQCKVAVSLYIQMEYCGMSLDEYIAQTPEVDPERNEEIVAMIISGLYQCHSAGVMHRDLKPSNIFIDKETGVVKIGDF
GLAFSEDMKQVPSSDRNRGLFEKDISSKNCSSIVTPNSATPDSKRVYGEQDEDCQGASSDVLYGGSRGVKEVLKGGEESA
QMRISRANTAGHQNLGKEEQQHYHRRSTHNLHPLPITPFLSATPLAGGTRPHSSVQDGTLYKTQVLQSSPGETPCVSCPE
YPKRGPHSEMSSAGRSSLLAERTTLISGVGEQERKSVDREKISLSPENFPGLCPSELPTGAVEHVEPSSLVMQKPRNDPT
KLKKEALSSVSPVVGEVPSLANVQRSHAACLTPRTTWEGLPNCQSPVFSALRRDLEKSETTILPRESFLSNVASTPHESP
NSGACLGPDAFEHPPNGCDTVKKRTAGVGTRAYAPPEQLQGGRYDFSVDIWALGLIVLDLFTRCNTAMEQAMNFRNARDG
RFPPSVTSTYPWVVPFCRWCLQNDPSKRPTIRQLYQHYCSTGSVFGPKTATSRCSASGLLSHTEDNNVVFPLCLPLPHIW
TGTCLPHRLLPSDDFFHSPRSGVLVNVDSHARNDDSLGGTVGLGQTQWQNSVVALSPPACGSYEFCDQASSSCFDAHISG
QSHPPQSYASSPLRIPCNHSCFPADLSPLSLSRSPRESAHTSTCVAGERSCGDTARSPTCVCGPSAHASPAISTRLGCCA
CPITGPCRGEAVDEPNFCVVRDSEGEDNTLLSGCSCMSISAGSSRRPESPWQGQHMNTPSTCPSTTFIGCSACQCPFCAC
CVCRGCSGAVCEVFPAEGLASSAASGGPVSPTALKLSSEGRMFKDTSSEVWGQPGVALARCRKFPTPWSFSPAVVHGDES
KTSPPHNWSRPAQEPDSCHLWYMLPPPRTLLP

Gene-Specific Links for TGME49_111510

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins