ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_111470 (RON5)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
rhoptry neck during intracellular tachyzoite and tachyzoite
moving junction during intracellular tachyzoite and tachyzoite invasion
cytosolic side of host cell membrane during tachyzoite

Who localised this protein by microscopy?

Straub, K. W., Cheng, S. J., Sohn, C. S., Bradley, P. J.
Novel components of the Apicomplexan moving junction reveal conserved and coccidia-restricted elements. (2009 Apr, Cell Microbiol) PubMed / full text
   more detail about this publication

moving junction and rhoptry neck during intracellular tachyzoite
  • "To determine if this protein is indeed a MJ/RON protein, we raised antibodies against the N-terminal and C-terminal portions of the protein and demonstrate that the 110 and 45 kDa forms are present in lysates of extracellular parasites (Fig. 1A and B). We then used the antibodies in immunofluorescence assays and were able to show that both fragments are present in the rhoptry necks and are released into the MJ in invading parasites (Fig. 1C). These results demonstrate that 583.m00636 is a processed MJ/RON protein that we have named RON5, and its cleavage products RON5N and RON5C respectively."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RHΔhpt
  • Gene model mapping comments: taken directly from 19134112
  • Localisation record: rhoptry neck and moving junction during intracellular tachyzoite
  • Other genes localised in this publication: hypothetical protein, hypothetical protein, conserved

Besteiro, S., Michelin, A., Poncet, J., Dubremetz, J. F., Lebrun, M.
Export of a Toxoplasma gondii rhoptry neck protein complex at the host cell membrane to form the moving junction during invasion. (2009 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

moving junction during tachyzoite invasion, cytosolic side of host cell membrane and rhoptry neck during tachyzoite
  • "RON2, RON4, RON5, and RON8 are all present at the MJ during invasion... we demonstrate that RONs are exported to the host cell membrane, RON/4/5/8 being exposed to the host cell cytosol and RON2 being probably an integral membrane protein that displays a privileged interaction with AMA1."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH HXGPRT–
  • Gene model mapping comments: Taken directly from 19247437
  • Localisation record: moving junction during tachyzoite invasion, rhoptry neck during tachyzoite, cytosolic side of host cell membrane during tachyzoite
  • Other genes localised in this publication: hypothetical protein, rhoptry neck protein 2, hypothetical protein, SRS29B (= SAG1, P30), dense granule protein 5 precursor

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115852

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_111470 hypothetical protein
MNHLQATYDDPLTIVQVALDLAARCEGYSAAKDQPAQAMRGPARVRRATGESTTFTIRGGGVQGGTMSFVEAEADDERKE
DSEDNTVDLSEQDQDSSFVQLKKLFNRRGSSAAGQAVQTDAQPLPKAVQTDAQPLPKVRRGGPDVDASAVILGSRFMLDL
WCSKYRKMLVEKLSGISTKDATVMQQEISKVFSAVSSIKIAIPDYKDLWDFSLRCDWMDGYPDAEKMRAARAEMVTYAMA
KASTGKRLKRMLQKVRSWIRKKAFAAARKLKSLKNRISTAFGRGKPPKAKVPDWAVVNAGMGMWTGKVFSTHLTFNEDEM
SCNGPHEPIRVMSWKQNHFTTFASSSTNAERNYVLVKKGDDSHCWATREALVHKGWSGIPVYQYAEPAGFWLQEVSPSNQ
PFVVNWDGYLTTSDNLTLQDIDINASSDSLKSHAVMRIVDSNGKTIYQGPPTGVVQTQGGVVTLGSIRNLVSGVHSTGDS
VEVRVTASGPQLTSVADLDTQFKEIPDLVLR

Gene-Specific Links for TGME49_111470

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins