ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_111430 (Fibrillarin)

fibrillarin, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleolus during tachyzoite

Who localised this protein by microscopy?

White, M. W., Jerome, M. E., Vaishnava, S., Guerini, M., Behnke, M., Striepen, B.
Genetic rescue of a Toxoplasma gondii conditional cell cycle mutant. (2005 Feb, Mol Microbiol) PubMed / full text
   more detail about this publication

nucleolus during tachyzoite
  • "anti-fibrillarin antibodies (FIB, nucleolus-specific protein)"
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody directly to homologue
  • Strain: RH
  • Gene model mapping comments: Blast from UniProt P15646, annotation matches
  • Localisation record: nucleolus during tachyzoite
  • Comment: Has this antibody ever been characterised directly in Toxoplasma? It appears to be there for colocalisation purposes only
  • Other genes localised in this publication: exonuclease domain-containing protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10655

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_111430 fibrillarin, putative
MRGGFRGGGGRGGSGGGRGGGRGGGRGGGGGFKASRGGGRGGRGGGRGGGGRGRGGRGGLGGKGGPQKVLVVPHRFEGIF
MSKGKADSLVTRNMVPGESVYGEKRLEVAEESGEKIEYRVWNPFRSKLGATIVGGVANMPIKPGSKVLYLGAANGTTVSH
VSDIVGPEGVVYAVEFSHRSGRDLTNMAKKRQNIVPIVEDARQPLKYRMLVGMVDVIFADVAQPDQSRIVALNAHHFLKA
GGWFVISIKANCVDSTAKPEAVFAAEVDKLRKEKCKPKEQLTLEPYHRDHAVVIGQYRVSKKKD

Gene-Specific Links for TGME49_111430

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins