ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_111360 (PKG)

AGC kinase TgPKG1, a gene from Toxoplasma gondii

Compiled localisation
cytosol and parasite plasma membrane during tachyzoite

Who localised this protein by microscopy?

Donald, R. G., Liberator, P. A.
Molecular characterization of a coccidian parasite cGMP dependent protein kinase. (2002 Apr 9, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol and parasite plasma membrane during tachyzoite
  • "(B) Anti-FLAG immunofluorescence observed in a subset of transgenic parasites represented in (A) illustrating membrane and cytosolic localization of recombinant PKGs."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: blast from AF413570, annotation matches
  • Localisation record: membrane and cytosol during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11039

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_100820 cGMP-dependent protein kinase
  • PY02304 cGMP-dependent protein kinase-related
  • PVX_084705 cGMP-dependent protein kinase, putative
  • PCHAS_100910 cGMP-dependent protein kinase, putative
  • PKH_131265 cGMP-dependent protein kinase, putative
  • NCLIV_055260 AGC kinase TgPKG1, putative
  • cgd8_750 cyclic nucleotide (cGMP)-dependent protein kinase with 3 cNMP binding domains and a Ser/Thr kinase domain
  • Chro.80094 cGMP-dependent protein kinase
  • CMU_024660 protein kinase domain-containing protein
  • TA04955 cGMP-dependent protein kinase, putative
  • BBOV_I004690 cGMP dependent protein kinase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_111360 AGC kinase TgPKG1
MGACISKNSSARVSRSSALSASKQTVAASAPPGAAGDETSATGAAEEASRNSLARVDGTRASAAELERAPDGVCPDREEP
GTANAEQGGVTEKKDTRETLAGMNSPKTLEAEAQEDDLKREAPNQDVPSEAPEGPKEKPGGDRKPAQKAILKQDDSHTEE
EKLNAHLAYREKTPADFALIQDSLKANLVCSSLNEGEIDALAVAMQFFTFKKGDVVTKQGEPGSYFFIIHSGTFDVLVND
KRVNAMDKGKAFGEIALIHNTERSATVVASSTEGALWGVQRHTFRETLKQLSSRNFAENRQFLASVKFFEMLTEAQKNVI
TNALVVENFKPGQPIVKEGDAGDVLYILKSGKAKVSIGGREIRMLRKGDYFGERALLYKEPRSATITAEEFTVCVSIGRE
LLDRVLGNLQHVLFRNIMVEALQQSKVYELFQGDQLSKLIEAAVVKDYGADYVILDKENKTKGIRFFFVLEGELSVYAYA
QNPATKEEERKLAATLKRGQAFGEEYVLNPTRPFNHYVKSVGPCKLALFTSSVLTATLGGEDIDETLDFNNKRAIIRKMY
IFRYLSDHQMTMLIKAFKTVRYMSGEYIIKEGERGTRFFIIKAGEVAILKNNKRLRTLGRHDYFGERALLYDEPRTASVC
ANSAGVDLWVVDKSVFNEIIKGPMLAHLEERIRMQDTKVEFQDLQVVRVVGRGTFGTVKLVRHVPTDIRYALKCVSRRSV
IALSQQQHIRLEREIMAENDHPFIIRLVRTFRDKEFLYFLTELVTGGELYDAIRKLGLLARSQAQFYLASIVLAIEYLHE
RNIAYRDLKPENILLDSQGYVKLIDFGCAKKMQGRAYTLVGTPHYMAPEVILGKGYTLTADTWAFGVCLYEFMCGPLPFG
NDAEDQLEIFRDILTGKLVFPHYVTDQDAINLMKRLLCRLPEVRIGCSINGYKDIKEHAFFGDFDWDKLAGRGLPPPLAP
KGETYAEDTEQSSFELDEDDTIVLEDEYDWDKDF

Gene-Specific Links for TGME49_111360

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins