ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_111310 ()

serine/threonine protein phosphatase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10634

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_122740 protein phosphatase, putative
  • PY02315 protein phosphatase 2B-related
  • PVX_093605 serine/threonine protein phosphatase 2b (catalytic subunit), putative
  • PCHAS_122800 protein phosphatase, putative
  • PKH_011550 serine/threonine protein phosphatase, putative
  • TGME49_111310 serine/threonine protein phosphatase, putative
  • NCLIV_055230 serine/threonine protein phosphatase, putative
  • cgd6_4200 protein phosphatase 2B catalytic subunit, calcineurin like phosphatse superfamily
  • Chro.60481 protein phosphatase 2b
  • CMU_020560 serine/threonine protein phosphatase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_111310 serine/threonine protein phosphatase, putative
MEPLADPLHDRVVTSVQPPPAQPLKHSLLYPSGPANPPNWQELKSHLQREGRLSKEDCLELIKNVTEITSNEPNLLRLND
PITVVGDIHGQFYDLLKLLDVGGDPDTTQYLFLGDYVDRGSFSIEVLLLLYAIKLNHPTRVWLLRGNHECRQMTSFFNFR
DECECKYDMTVYFAFMEAFDSLPLAAVINGKFLALHGGLSPELKVLSQIGGVNRFQEPPRGGLFCDLLWADPLDESKDDV
GQSPEDSFTPNDVRGCSFFFGYSAASKFLDRNGLLSVLRAHEAQLEGYKMHQTNQKTGFPTVITIFSAPNYCDVYNNKGA
VLKFENNTLNIQQFNFSPHPYHLPNFMDVFTWSIPFVSEKVTEMLYGILNPSIDDDEDDEDVDDVELPPAVLSIMKAHLP
SDEASGQRHPPAGDNRLSKERADALRKKVQSVGRLMRVFKTLRQENELIVRLKGCTPGHRIPVGLLLQGREGIANELDKF
ENAKQIDLMNERRPDGGSSSR

Gene-Specific Links for TGME49_111310

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins