ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_111090 ()

ubiquitin carboxyl-terminal hydrolase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11327

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFE1355c ubiquitin carboxyl-terminal hydrolase, putative
  • PBANKA_124200 ubiquitin carboxyl-terminal hydrolase, putative
  • PY03738 tRNA-guaninine transglycosylase, putative, putative
  • PVX_079880 ubiquitin carboxyl-terminal hydrolase, putative
  • PCHAS_124240 ubiquitin carboxyl-terminal hydrolase, putative
  • PKH_100480 ubiquitin carboxyl-terminal hydrolase, putative
  • TGME49_111090 ubiquitin carboxyl-terminal hydrolase, putative
  • NCLIV_055070 Ubiquitin carboxyl-terminal hydrolase (EC 3.1.2.15), related
  • cgd1_290 Ub6p like ubiquitin at N-terminus and ubiquitin C terminal hydrolase at the C-terminus
  • Chro.10040 tRNA-guaninine transglycosylase
  • CMU_034960 ubiquitin carboxyl-terminal hydrolase family protein
  • TA10095 ubiquitin C-terminal hydrolase, putative
  • BBOV_III008630 ubiquitin carboxyl-terminal hydrolase family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_111090 ubiquitin carboxyl-terminal hydrolase, putative
MDSIRISVKWNKQEFENVEVDLSEPLALLNAQLMTLTGVPADRQKLMANRKLVKTVDDLRAAAKGGKNLRVTMLGTAEGA
ELQQPLERTVFVEDLTPAERAKLLREKNIEPLPPGITNLGNTCYLASVLQMLRPCRELTAAVKNDMKNSTGESAAAYTAL
SGAVGAAYRLALALKDFHSHWDSTAGAAQPVLLVHALREAFPQFARKAAAGPGGLGGGFMQQDAEECLSCLVNVLGESLP
ISQNRKAFEALPVRYEQATNFVDALFAFDMQVKTCRTRGEEALADGAAEVKREKNTKFTCFLGTMQNPVNTLDEGVKFSL
AEERIDLTAAGNAGSNAPLDAEKEMLLRSMQFASLPFYLLVQFMRFEWKRAGGQAEKAKVCRSVKFGPTLDLYLHCTDEL
KESLRIGRAVVALRREREAGGHSSDSKTEETNSKTEPTCADAAMTEKNEDSNVSSTGSTRVYRTGFFQLLGIVTHQGRHA
DSGHYVGWTKKDQREPRVIEKEKKEKEREEELQREENPSGMAVKKKKASPVDMWVKFDDDKVSETPWDQIDLAGGRSDYH
IAYLLLFREILVDATEEEVKTVEKNHAEQLAQTDAAKKSNGEEKNTQ

Gene-Specific Links for TGME49_111090

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins