ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_110750 ()

hypothetical protein, conserved, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_19256

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFD1037w conserved Plasmodium protein, unknown function
  • PBANKA_052250 conserved Plasmodium protein, unknown function
  • PY05566 hypothetical protein
  • PVX_090145 hypothetical protein, conserved
  • PCHAS_052270 conserved Plasmodium protein, unknown function
  • PKH_052550 conserved Plasmodium protein, unknown function
  • TGME49_110750 hypothetical protein, conserved
  • NCLIV_054800 hypothetical protein, conserved
  • cgd8_5140 possible coated vesicle proteins, emp24/gp25L/p24 family, signal peptide, possible transmembrane domain at C-terminus
  • Chro.80586 hypothetical protein
  • CMU_011650 hypothetical protein, conserved
  • TP01_0326 hypothetical protein
  • TA21230 P24 family protein, putative
  • BBOV_IV004270 conserved, membrane protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_110750 hypothetical protein, conserved
MKALLVLSALLAACLQGRLASAADQTDGVPPDSQQDYQNYQQNQYYAPEEENGVPPPPPVNTYGSADVGSNAGGTPPAAA
PYYPPPQQQGYVPQDQQGYAPPAQQGYNAPPQVPPSHQVPPQYQQQYVPQYQQQRQQGYAQQYAGGVPPQQAQGGYQQNR
PAPGPQGGSGYGAPAPVGQQAPPPPQYKAPPPQGTPQQGYPQGGARAPPPASARTGQPAPAAAAPGYQTQRQGQQPQRPA
PVGQVPQAGQPAPARQQQRPTPPAQQPRQSPPPPQQTPQQTQQRTPSQQTQQQRAAAPQQARQAPAASQQQRPVQTGGAN
QGAGTPRAGVQTPQAGVGAGVQTPQAQGGATQQRQQAQRAAPQRAEMKPAAPDEDSEEEEGDLEERIRREDEGQLFDDDD
DSASSLMEEWEKHMQNFIPDMLVTFPLAPRSDEYFYEHIEANDGAVHLRGGFFVGGDEGSASVDFSITDPDGDIIYKKSK
SEGLFYFTAKKKGTYSFIVSNHQWLESRMVTFAIGRGNETALMPKHVQTAGEMADTLQNQLRDIQAETTYLWIRQRSHAE
AATALHSKLFWLAVVEFACLITTSAFHVFYIQSLVSDKRIL

Gene-Specific Links for TGME49_110750

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins